1ar7

P1/MAHONEY POLIOVIRUS, DOUBLE MUTANT P1095S + H2142Y

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

P1/MAHONEY POLIOVIRUS

Human poliovirus 1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	P1/MAHONEY POLIOVIRUS × 60 P1/MAHONEY POLIOVIRUS × 60 （P03299） SPHINGOSINE × 60 MYRISTIC ACID × 60 water × 300	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	P1/MAHONEY POLIOVIRUS × 1 P1/MAHONEY POLIOVIRUS × 1 （P03299） SPHINGOSINE × 1 MYRISTIC ACID × 1 water × 5	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	P1/MAHONEY POLIOVIRUS × 5 P1/MAHONEY POLIOVIRUS × 5 （P03299） SPHINGOSINE × 5 MYRISTIC ACID × 5 water × 25	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	P1/MAHONEY POLIOVIRUS × 6 P1/MAHONEY POLIOVIRUS × 6 （P03299） SPHINGOSINE × 6 MYRISTIC ACID × 6 water × 30	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	P1/MAHONEY POLIOVIRUS × 1 P1/MAHONEY POLIOVIRUS × 1 （P03299） SPHINGOSINE × 1 MYRISTIC ACID × 1 water × 5	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 150	P1/MAHONEY POLIOVIRUS × 30 P1/MAHONEY POLIOVIRUS × 30 （P03299） SPHINGOSINE × 30 MYRISTIC ACID × 30 water × 150	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLH_POL1M
Isoform	—
PDB entities	2, 3, 4
Chains and sequence ranges	Author chain 1； PDBConstruct 1–302； UniProt 579–880 Author chain 2； PDBConstruct 1–272； UniProt 69–340 Author chain 3； PDBConstruct 1–238； UniProt 341–578

P1/MAHONEY POLIOVIRUS

Human poliovirus 1

UniProt P03299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	P1/MAHONEY POLIOVIRUS × 60 P1/MAHONEY POLIOVIRUS × 60 （P03300） P1/MAHONEY POLIOVIRUS × 60 （P03300） P1/MAHONEY POLIOVIRUS × 60 （P03300） SPHINGOSINE × 60 MYRISTIC ACID × 60 water × 300	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	P1/MAHONEY POLIOVIRUS × 1 P1/MAHONEY POLIOVIRUS × 1 （P03300） P1/MAHONEY POLIOVIRUS × 1 （P03300） P1/MAHONEY POLIOVIRUS × 1 （P03300） SPHINGOSINE × 1 MYRISTIC ACID × 1 water × 5	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	P1/MAHONEY POLIOVIRUS × 5 P1/MAHONEY POLIOVIRUS × 5 （P03300） P1/MAHONEY POLIOVIRUS × 5 （P03300） P1/MAHONEY POLIOVIRUS × 5 （P03300） SPHINGOSINE × 5 MYRISTIC ACID × 5 water × 25	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	P1/MAHONEY POLIOVIRUS × 6 P1/MAHONEY POLIOVIRUS × 6 （P03300） P1/MAHONEY POLIOVIRUS × 6 （P03300） P1/MAHONEY POLIOVIRUS × 6 （P03300） SPHINGOSINE × 6 MYRISTIC ACID × 6 water × 30	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	P1/MAHONEY POLIOVIRUS × 1 P1/MAHONEY POLIOVIRUS × 1 （P03300） P1/MAHONEY POLIOVIRUS × 1 （P03300） P1/MAHONEY POLIOVIRUS × 1 （P03300） SPHINGOSINE × 1 MYRISTIC ACID × 1 water × 5	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 150	P1/MAHONEY POLIOVIRUS × 30 P1/MAHONEY POLIOVIRUS × 30 （P03300） P1/MAHONEY POLIOVIRUS × 30 （P03300） P1/MAHONEY POLIOVIRUS × 30 （P03300） SPHINGOSINE × 30 MYRISTIC ACID × 30 water × 150	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_POL1M
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 1–68； UniProt 1–68

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ar7
Deposition date deposition_date	1997-08-11
Structure title title	P1/MAHONEY POLIOVIRUS, DOUBLE MUTANT P1095S + H2142Y
Keywords keywords	PICORNAVIRUS, POLIOVIRUS, COAT PROTEIN, Icosahedral virus, Virus; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ar7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ar7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ar7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	131.70 Å
Total Rg	131.70 Å
Atom count	400140
Residues	51060
Excluded volume	7114500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ar7__assembly_1__model_1`	300-MERIC （300）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ar7__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`1ar7__assembly_3__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`1ar7__assembly_4__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`1ar7__assembly_5__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`1ar7__assembly_6__model_1`	150-meric （150）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	P1/MAHONEY POLIOVIRUS
Molecular weight formula_weight	437.4 kDa
Mutation mutation	CHAIN 1, P95S, CHAIN 2, H142Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0
Atom count atom_count	7212

GSSST

Source Source

Source organism organism	Human poliovirus 1
NCBI taxonomy ID ncbi_taxonomy_id	12081

Entity 2 Entity 2 polymer

Description description	P1/MAHONEY POLIOVIRUS
Molecular weight formula_weight	33478.6 kDa
Mutation mutation	CHAIN 1, P95S, CHAIN 2, H142Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

GLGQMLESMIDNTVRETVGAATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY

Source Source

Source organism organism	Human poliovirus 1
NCBI taxonomy ID ncbi_taxonomy_id	12081

Entity 3 Entity 3 polymer

Description description	P1/MAHONEY POLIOVIRUS
Molecular weight formula_weight	30100.8 kDa
Mutation mutation	CHAIN 1, P95S, CHAIN 2, H142Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SPNIEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMYTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQ

Source Source

Source organism organism	Human poliovirus 1
NCBI taxonomy ID ncbi_taxonomy_id	12081

Entity 4 Entity 4 polymer

Description description	P1/MAHONEY POLIOVIRUS
Molecular weight formula_weight	26547.5 kDa
Mutation mutation	CHAIN 1, P95S, CHAIN 2, H142Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSATKKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTIDDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLLRDTTHIEQKALAQ

Source Source

Source organism organism	Human poliovirus 1
NCBI taxonomy ID ncbi_taxonomy_id	12081

Entity 5 Entity 5 polymer

Description description	P1/MAHONEY POLIOVIRUS
Molecular weight formula_weight	7393.1 kDa
Mutation mutation	CHAIN 1, P95S, CHAIN 2, H142Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN

Source Source

Source organism organism	Human poliovirus 1
NCBI taxonomy ID ncbi_taxonomy_id	12081

Entity 6 Entity 6 non-polymer

Description description	SPHINGOSINE
Molecular weight formula_weight	299.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	543

▼

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1ar7.1
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d1ar71_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d1ar73_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

CATH v4.4 (4 domains)

Domain ID domain_id	1ar7100
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ar7200
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ar7300
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ar7400
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	80 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	10 — Picornavirus coat protein VP4

▶

Unit-cell length a length_a	319.950 Å
Unit-cell length b length_b	355.100 Å
Unit-cell length c length_c	377.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	120

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	11.000 Å
R factor r_factor	—
R_work r_work	0.2340
R_free r_free	—

P1/MAHONEY POLIOVIRUS, DOUBLE MUTANT P1095S + H2142Y

1. Protein Identity and Related Structures Protein Identity & Related Structures

P1/MAHONEY POLIOVIRUS

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

P1/MAHONEY POLIOVIRUS

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ar7__assembly_1__model_1

1ar7__assembly_1__model_1 | I(q)

1ar7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

7. Citations (3)