SAXSdb — 1ben

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HUMAN INSULIN

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 1 water × 2	Consistent with protein count
10	Protein homooligomer	Homooligomer	Protein 9	ZINC ION × 6 4-HYDROXYBENZAMIDE × 3 CHLORIDE ION × 3 water × 9	Consistent with protein count
11	Protein homooligomer	Homooligomer	Protein 9	ZINC ION × 6 4-HYDROXYBENZAMIDE × 3 CHLORIDE ION × 3 water × 9	Consistent with protein count
12	Protein homooligomer	Homooligomer	Protein 9	ZINC ION × 6 4-HYDROXYBENZAMIDE × 6 CHLORIDE ION × 3 water × 9	Consistent with protein count
13	Protein homooligomer	Homooligomer	Protein 6	ZINC ION × 6 4-HYDROXYBENZAMIDE × 3 CHLORIDE ION × 3 water × 6	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 1 4-HYDROXYBENZAMIDE × 2 CHLORIDE ION × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 12	ZINC ION × 6 4-HYDROXYBENZAMIDE × 6 CHLORIDE ION × 3 water × 12	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 12	ZINC ION × 6 4-HYDROXYBENZAMIDE × 6 CHLORIDE ION × 3 water × 12	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 12	ZINC ION × 6 4-HYDROXYBENZAMIDE × 6 CHLORIDE ION × 3 water × 12	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 9	ZINC ION × 3 4-HYDROXYBENZAMIDE × 3 water × 9	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 6	ZINC ION × 3 4-HYDROXYBENZAMIDE × 6 CHLORIDE ION × 3 water × 6	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 6	ZINC ION × 3 water × 6	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 9	ZINC ION × 6 4-HYDROXYBENZAMIDE × 6 CHLORIDE ION × 3 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INS_HUMAN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–21； UniProt 31–51 Author chain C； PDBConstruct 1–21； UniProt 31–51 Author chain B； PDBConstruct 1–30； UniProt 1–30 Author chain D； PDBConstruct 1–30； UniProt 1–30

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ben
Deposition date deposition_date	1996-02-15
Structure title title	INSULIN COMPLEXED WITH 4-HYDROXYBENZAMIDE
Keywords keywords	INSULIN, HORMONE, GLUCOSE METABOLISM; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ben__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ben__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ben__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	11.55 Å
Rg (electron density)	10.07 Å
Total Rg	11.63 Å
Atom count	745
Residues	50
Excluded volume	6788 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ben__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ben__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1ben__assembly_3__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1ben__assembly_4__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1ben__assembly_5__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1ben__assembly_6__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`1ben__assembly_7__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`1ben__assembly_8__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`1ben__assembly_9__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`1ben__assembly_10__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`1ben__assembly_11__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`1ben__assembly_12__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`1ben__assembly_13__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	HUMAN INSULIN
Molecular weight formula_weight	2383.7 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	1713

GIVEQCCTSICSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	HUMAN INSULIN
Molecular weight formula_weight	3434.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	4-HYDROXYBENZAMIDE
Molecular weight formula_weight	137.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	168

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1ben.1
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

Domain ID domain_id	d1ben.2
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

▶

Unit-cell length a length_a	80.720 Å
Unit-cell length b length_b	80.720 Å
Unit-cell length c length_c	37.630 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.400 Å
Low-resolution limit resolution_low	8.000 Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

INSULIN COMPLEXED WITH 4-HYDROXYBENZAMIDE

1. Protein Identity and Related Structures Protein Identity & Related Structures

HUMAN INSULIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ben__assembly_1__model_1

1ben__assembly_1__model_1 | I(q)

1ben__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (7)

INSULIN COMPLEXED WITH 4-HYDROXYBENZAMIDE

1. Protein Identity and Related Structures Protein Identity & Related Structures

HUMAN INSULIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ben__assembly_1__model_1

1ben__assembly_1__model_1 | I(q)

1ben__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (7)