1bl8

POTASSIUM CHANNEL (KCSA) FROM STREPTOMYCES LIVIDANS

Method: X-RAY DIFFRACTION D_max: 66.5 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (POTASSIUM CHANNEL PROTEIN)

Streptomyces lividans

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 23–119 Chain B； UniProt 23–119 Chain C； UniProt 23–119 Chain D； UniProt 23–119	Mutation：L90C	K POTASSIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.5；ONE-TO-MIXTURE OF PROTEIN SOLUTION AND RESERVOIR (200 MM CACL2, 100 MM HEPES PH 7.5, 48% PEG 400).	Resolution 3.20 Å R-free 0.290

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1BL8	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1F6G POTASSIUM CHANNEL (KCSA) FULL-LENGTH FOLD Deposited 2000-06-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–160（160 aa） Fragment：FULL-LENGTH CHANNEL Chain B 1–160（160 aa） Fragment：FULL-LENGTH CHANNEL Chain C 1–160（160 aa） Fragment：FULL-LENGTH CHANNEL Chain D 1–160（160 aa） Fragment：FULL-LENGTH CHANNEL	Mutation：CYS SCANNING: 5-24, 120-160 Mutation：CYS SCANNING: 5-24, 120-160 Mutation：CYS SCANNING: 5-24, 120-160 Mutation：CYS SCANNING: 5-24, 120-160	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.2；293 K；Ionic strength (raw mmCIF value) 50-100 mM；Pressure ambient NMR sample composition 50-100 uM KcsA, PBS pH 7.2, reconstituted into asolectin vesicles at a 1:500 protein:lipid ratio (molar) \| 100% H2O	Resolution not provided
1J95 KCSA potassium channel with TBA (tetrabutylammonium) and potassium Deposited 2001-05-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–125（125 aa） Fragment：Residues 1-125 Chain B 1–125（125 aa） Fragment：Residues 1-125 Chain C 1–125（125 aa） Fragment：Residues 1-125 Chain D 1–125（125 aa） Fragment：Residues 1-125	Mutation：L90C Mutation：L90C Mutation：L90C Mutation：L90C	K POTASSIUM ION × 4 TBA TETRABUTYLAMMONIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；PEG 400, HEPES, POTASSIUM CHLORIDE, CALCIUM CHLORIDE, DETERGENT LDAO, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.80 Å R-free 0.322
1JQ1 POTASSIUM CHANNEL (KCSA) OPEN GATE MODEL Deposited 2001-08-03	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119) Chain B 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119) Chain C 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119) Chain D 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；150 K；Ionic strength (raw mmCIF value) 20 mM CITRATE PHOSPHATE；Pressure 1 NMR measurement conditions pH 4；150 K；Ionic strength (raw mmCIF value) 20 mM CITRATE PHOSPHATE；Pressure 1 NMR sample composition 1.0 MG/ML MIXED WITH METHANETHIOSULFONATE SPIN LABEL \| THE SAMPLES WERE RECONSTITUTED INTO ASOLECTIN LIPOSOMES AT A 1:400 PROTEIN:LIPID RATIO	Resolution not provided
1JQ2 POTASSIUM CHANNEL (KCSA) OPEN GATE MODEL Deposited 2001-08-03	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119) Chain B 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119) Chain C 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119) Chain D 86–119（34 aa） Fragment：INNER TRANSMEMBRANE SEGMENT (residues 86-119)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；150 K；Ionic strength (raw mmCIF value) 20 mM CITRATE PHOSPHATE；Pressure 1 NMR measurement conditions pH 4；150 K；Ionic strength (raw mmCIF value) 20 mM CITRATE PHOSPHATE；Pressure 1 NMR sample composition 1.0 MG/ML MIXED WITH METHANETHIOSULFONATE SPIN LABEL \| THE SAMPLES WERE RECONSTITUTED INTO ASOLECTIN LIPOSOMES AT A 1:400 PROTEIN:LIPID RATIO	Resolution not provided
1JVM KCSA POTASSIUM CHANNEL WITH TBA (TETRABUTYLAMMONIUM) AND RUBIDIUM Deposited 2001-08-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–125（125 aa） Fragment：Residues 1-125 Chain B 1–125（125 aa） Fragment：Residues 1-125 Chain C 1–125（125 aa） Fragment：Residues 1-125 Chain D 1–125（125 aa） Fragment：Residues 1-125	Mutation：P2A,L90C Mutation：P2A,L90C Mutation：P2A,L90C Mutation：P2A,L90C	RB RUBIDIUM ION × 3 TBA TETRABUTYLAMMONIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；PEG400,calcium chloride, Hepes, potassium chloride, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.80 Å R-free 0.302
1JVM KCSA POTASSIUM CHANNEL WITH TBA (TETRABUTYLAMMONIUM) AND RUBIDIUM Deposited 2001-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–125（125 aa） Fragment：Residues 1-125 Chain B 1–125（125 aa） Fragment：Residues 1-125 Chain C 1–125（125 aa） Fragment：Residues 1-125 Chain D 1–125（125 aa） Fragment：Residues 1-125	Mutation：P2A,L90C Mutation：P2A,L90C Mutation：P2A,L90C Mutation：P2A,L90C	RB RUBIDIUM ION × 6 TBA TETRABUTYLAMMONIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；PEG400,calcium chloride, Hepes, potassium chloride, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.80 Å R-free 0.302
1K4C Potassium Channel KcsA-Fab complex in high concentration of K+ Deposited 2001-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：potassium channel KcsA	Mutation：P2A, L90C	F09 NONAN-1-OL × 4 K POTASSIUM ION × 28 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；298 K；PEG 400, Magnesium Acetate, Sodium Acetate, pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.00 Å R-free 0.233
1K4D Potassium Channel KcsA-Fab complex in low concentration of K+ Deposited 2001-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：potassium channel KcsA	Mutation：P2A, L90C	K POTASSIUM ION × 8 NA SODIUM ION × 4 DGA DIACYL GLYCEROL × 4 F09 NONAN-1-OL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；298 K；PEG 400,Magnesium Acetate, Sodium Acetate , pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.235
1R3I potassium channel KcsA-Fab complex in Rb+ Deposited 2003-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A,L90C	F09 NONAN-1-OL × 4 RB RUBIDIUM ION × 16 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；293 K；PEG400, sodium acetate, magnesium acetate, pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.236
1R3J potassium channel KcsA-Fab complex in high concentration of Tl+ Deposited 2003-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A,L90C	F09 NONAN-1-OL × 4 TL THALLIUM (I) ION × 20 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；293 K；PEG400, sodium acetate, magnesium acetate, pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.90 Å R-free 0.228
1R3K potassium channel KcsA-Fab complex in low concentration of Tl+ Deposited 2003-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A,L90C	DGA DIACYL GLYCEROL × 4 TL THALLIUM (I) ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；293 K；PEG400, sodium acetate, magnesium acetate, pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.80 Å R-free 0.273
1R3L potassium channel KcsA-Fab complex in Cs+ Deposited 2003-10-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A,L90C	F09 NONAN-1-OL × 4 CS CESIUM ION × 20 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；293 K；PEG400, sodium acetate, magnesium acetate, pH 5.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.41 Å R-free 0.249
1ZWI Structure of mutant KcsA potassium channel Deposited 2005-06-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 22–123（102 aa） Fragment：residues 22-123	Not recorded	F09 NONAN-1-OL × 1 K POTASSIUM ION × 7 DGA DIACYL GLYCEROL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.256
2A9H NMR structural studies of a potassium channel / charybdotoxin complex Deposited 2005-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–132（132 aa） Chain B 1–132（132 aa） Chain C 1–132（132 aa） Chain D 1–132（132 aa）	Mutation：Q58A, T61S, R64D, F103Y, T107F, L110V Mutation：Q58A, T61S, R64D, F103Y, T107F, L110V Mutation：Q58A, T61S, R64D, F103Y, T107F, L110V Mutation：Q58A, T61S, R64D, F103Y, T107F, L110V	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；315 K；Pressure ambient NMR sample composition 1 mM KcsA, 2H and selectively 13C-methyl labeled in 20 mM sodium phosphate (pH 7.5), 5 mM KCl, 1 mM DTT, and 80 mM foscholine-12, 90% H2O/10% D2O or 100% D2O \| 90% H2O/10% D2O or 100% D2O	Resolution not provided
2ATK Structure of a mutant KcsA K+ channel Deposited 2005-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–124（124 aa）	Not recorded	K POTASSIUM ION × 7 F09 NONAN-1-OL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；300 K；PEG400, KCl, MgAcetate, NaAcetate, pH 5.40, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 2.50 Å R-free 0.261
2BOB Potassium channel KcsA-Fab complex in thallium with tetrabutylammonium (TBA) Deposited 2005-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：RESIDUES 1-124	Mutation：YES	TL THALLIUM (I) ION × 4 CO COBALT (II) ION × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.4；PEG 400, MAGNESIUM ACETATE, SODIUM ACETATE, pH 5.40	Resolution 2.76 Å R-free 0.251
2BOC Potassium channel KcsA-Fab complex in thallium with tetraethylarsonium (TEAs) Deposited 2005-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：RESIDUES 1-124	Mutation：YES	TL THALLIUM (I) ION × 16 CO COBALT (II) ION × 4 T1A TETRAETHYLARSONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.4；PEG 400, MAGNESIUM ACETATE, SODIUM ACETATE, pH 5.40	Resolution 3.01 Å R-free 0.250
2DWD crystal structure of KcsA-FAB-TBA complex in Tl+ Deposited 2006-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa） Fragment：residues 22-124	Mutation：L90C	F09 NONAN-1-OL × 4 TL THALLIUM (I) ION × 16 L2C (2S)-3-HYDROXY-2-(NONANOYLOXY)PROPYL LAURATE × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；18-25% PEG 400, 50mM MG(AC)2, 50mM NaAc(pH 5) or Na cacodylate(pH 6) or HEPES(pH 7), pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.60 Å R-free 0.263
2DWE Crystal structure of KcsA-FAB-TBA complex in Rb+ Deposited 2006-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa） Fragment：residues 22-124	Mutation：L90C	RB RUBIDIUM ION × 12 L2C (2S)-3-HYDROXY-2-(NONANOYLOXY)PROPYL LAURATE × 4 F09 NONAN-1-OL × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；18-25% PEG 400, 50mM MG(AC)2, 50mM NaAc(pH 5) or Na cacodylate(pH 6) or HEPES(pH 7), pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.266
2HJF Potassium channel kcsa-fab complex with tetrabutylammonium (TBA) Deposited 2006-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：L90C	K POTASSIUM ION × 16 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；295 K；Cryoprotected to 45% PEG, pH 5.2, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.90 Å R-free 0.284
2HVJ Crystal structure of KcsA-Fab-TBA complex in low K+ Deposited 2006-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A, L90C	F09 NONAN-1-OL × 4 K POTASSIUM ION × 8 L2C (2S)-3-HYDROXY-2-(NONANOYLOXY)PROPYL LAURATE × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；18-25% PEG 400, 50mM Mg(Ac)2, 50mM NaAc (pH5) or Na Cacodylate (pH6) or Hepes (PH 7), pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 2.75 Å R-free 0.246
2HVK crystal structure of the KcsA-Fab-TBA complex in high K+ Deposited 2006-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A, L90C	F09 NONAN-1-OL × 4 K POTASSIUM ION × 24 L2C (2S)-3-HYDROXY-2-(NONANOYLOXY)PROPYL LAURATE × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；18-25% PEG 400, 50mM Mg(Ac)2, 50mM NaAc (pH5) or Na Cacodylate (pH6) or Hepes (PH 7), pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 1.90 Å R-free 0.245
2IH1 Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation Deposited 2006-09-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 3–122（120 aa）	Mutation：S69A, V70C Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 20 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；293 K；Crystals grown in 150 mM KCl were transferred to a solution containing 1 mM KCl + 149 mM NaCl prior to cryoprotection, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 5.50	Resolution 2.40 Å R-free 0.251
2IH3 Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation Deposited 2006-09-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 3–122（120 aa）	Mutation：S69A, V70C Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 28 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；293 K；20-25% PEG 400, 50 mM Magnesium acetate, 150 mM KCl, pH 6.0. Crystals were cryoprotected by increasing PEG concentration to 40%, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.72 Å R-free 0.242
2ITC Potassium Channel KcsA-Fab complex in Sodium Chloride Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：residues 1-124	Mutation：L90C	NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；21% PEG400, 50 mM MgAcetate, 150 mM NaCl, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.20 Å R-free 0.265
2ITD Potassium Channel KcsA-Fab complex in Barium Chloride Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：RESIDUES 1-124	Mutation：L90C	BA BARIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；21% PEG400, 50 mM MgAcetate, 5 mM BaCl2, 150 mM NaCl, pH 6.2, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.70 Å R-free 0.261
2JK5 Potassium Channel KcsA in complex with Tetrabutylammonium in high K Deposited 2008-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：RESIDUES 1-124	Not recorded	CO COBALT (II) ION × 4 K POTASSIUM ION × 24 F09 NONAN-1-OL × 4 L2C (2S)-3-HYDROXY-2-(NONANOYLOXY)PROPYL LAURATE × 4 TBA TETRABUTYLAMMONIUM ION × 4 HP6 HEPTANE × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.4；18-25%PEG400, 50 MM SODIUM ACETATE, 50 MM MAGNESIUM ACETATE, pH 5.4	Resolution 2.40 Å R-free 0.249
2NLJ Potassium Channel KcsA(M96V)-Fab complex in KCl Deposited 2006-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：RESIDUES 1-124	Mutation：L90C, M96V	DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；PEG400, Magnesium Acetate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.52 Å R-free 0.255
2P7T Crystal Structure of KcsA mutant Deposited 2007-03-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 22–124（103 aa）	Not recorded	K POTASSIUM ION × 24 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；pH 5.2-5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.05 Å R-free 0.234
2P7T Crystal Structure of KcsA mutant Deposited 2007-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Not recorded	F09 NONAN-1-OL × 4 K POTASSIUM ION × 24 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；pH 5.2-5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.05 Å R-free 0.234
2QTO An anisotropic model for potassium channel KcsA Deposited 2007-08-02	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 23–119（97 aa） Chain B 23–119（97 aa） Chain C 23–119（97 aa） Chain D 23–119（97 aa）	Not recorded	K POTASSIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；200 MM CACL2, 100 MM HEPES PH 7.5, 48% PEG 400	Resolution 3.20 Å R-free 0.272
2W0F Potassium Channel KcsA-Fab Complex with Tetraoctylammonium Deposited 2008-08-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa） Fragment：RESIDUES 1-124	Not recorded	CO COBALT (II) ION × 4 F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 HX0 N,N,N-trioctyloctan-1-aminium × 4 K POTASSIUM ION × 28	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.4；18-25% PEG400, 50 MM SODIUM ACETATE, 50 MM MAGNESIUM ACETATE, pH 5.4	Resolution 2.40 Å R-free 0.241
3EFF The Crystal Structure of Full-Length KcsA in its Closed Conformation Deposited 2008-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain K 22–160（139 aa） Fragment：UNP residues 22-160 Chain L 22–160（139 aa） Fragment：UNP residues 22-160 Chain M 22–160（139 aa） Fragment：UNP residues 22-160 Chain N 22–160（139 aa） Fragment：UNP residues 22-160	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；340 mM (NH4)2SO4, 11% PEG4000, 100 mM Na3C6H5O7 pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.331
3F5W KcsA Potassium channel in the open-inactivated state with 32 A opening at T112 Deposited 2008-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa）	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；25% PEG 400, 50 mM Sodium acetate, 50mM magnesium acetate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.30 Å R-free 0.265
3F7V KcsA Potassium channel in the open-inactivated state with 23 A opening at T112 Deposited 2008-11-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 21–124（104 aa）	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.20 Å R-free 0.276
3F7V KcsA Potassium channel in the open-inactivated state with 23 A opening at T112 Deposited 2008-11-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa）	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.20 Å R-free 0.276
3F7Y KcsA Potassium channel in the partially open state with 17 A opening at T112 Deposited 2008-11-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.40 Å R-free 0.274
3F7Y KcsA Potassium channel in the partially open state with 17 A opening at T112 Deposited 2008-11-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.40 Å R-free 0.274
3FB5 KcsA potassium channel in the partially open state with 14.5 A opening at T112 Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, pH 5-6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.252
3FB5 KcsA potassium channel in the partially open state with 14.5 A opening at T112 Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, pH 5-6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.252
3FB6 KcsA Potassium channel in the partially open state with 16 A opening at T112 Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, pH 5-6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.00 Å R-free 0.255
3FB6 KcsA Potassium channel in the partially open state with 16 A opening at T112 Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, pH 5-6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.00 Å R-free 0.255
3FB7 Open KcsA potassium channel in the presence of Rb+ ion Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	RB RUBIDIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.30 Å R-free 0.255
3FB7 Open KcsA potassium channel in the presence of Rb+ ion Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	RB RUBIDIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.30 Å R-free 0.255
3FB8 KcsA Potassium channel in the open-conductive state with 20 A opening at T112 in the presence of Rb+ ion Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	RB RUBIDIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.40 Å R-free 0.304
3FB8 KcsA Potassium channel in the open-conductive state with 20 A opening at T112 in the presence of Rb+ ion Deposited 2008-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 21–124（104 aa） Fragment：UNP residues 21-124	Mutation：H25Q,L90C,R117Q,E120Q,R121Q,R122Q,H124Q	RB RUBIDIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.40 Å R-free 0.304
3GB7 Potassium Channel KcsA-Fab complex in Li+ Deposited 2009-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A, L90C	NI NICKEL (II) ION × 4 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；24% PEG 400, 100 mM MES, 50 mM Magnesium Acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.85 Å R-free 0.285
3HPL KcsA E71H-F103A mutant in the closed state Deposited 2009-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–124（124 aa） Fragment：UNP residues 1-124	Mutation：L90C,E71H,F103A	K POTASSIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；20-25% PEG 400, 50 mM magnesium acetate, 50 mM sodium acetate, pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.20 Å R-free 0.269
3IFX Crystal structure of the Spin-labeled KcsA mutant V48R1 Deposited 2009-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124 Chain B 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124 Chain C 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124 Chain D 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124	Mutation：V48C Mutation：V48C Mutation：V48C Mutation：V48C	K POTASSIUM ION × 2 MTN S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate × 4 TBA TETRABUTYLAMMONIUM ION × 1	Experimental method not declared X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；200 mM CaCl2, 150 mM KCl, 100 mM HEPES, 19-49% PEG 400, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.56 Å R-free 0.302
3IFX Crystal structure of the Spin-labeled KcsA mutant V48R1 Deposited 2009-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124 Chain B 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124 Chain C 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124 Chain D 1–123（123 aa） Fragment：Pore domain: UNP residues 1-124	Mutation：V48C Mutation：V48C Mutation：V48C Mutation：V48C	K POTASSIUM ION × 4 MTN S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate × 8 TBA TETRABUTYLAMMONIUM ION × 2	Experimental method not declared X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；200 mM CaCl2, 150 mM KCl, 100 mM HEPES, 19-49% PEG 400, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.56 Å R-free 0.302
3IGA Potassium Channel KcsA-Fab complex in Li+ and K+ Deposited 2009-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Mutation：P2A, L90C	NI NICKEL (II) ION × 4 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.75 Å R-free 0.273
3OGC KcsA E71A variant in presence of Na+ Deposited 2010-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 2–124（123 aa） Fragment：UNP RESIDUES 2-124	Mutation：E71A	NA SODIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG 400, MgAcetate, MES, pH 6.5, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 3.80 Å R-free 0.283
3OR6 On the structural basis of modal gating behavior in K+channels - E71Q Deposited 2010-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa） Fragment：UNP RESIDUES 22-124	Mutation：E71Q	K POTASSIUM ION × 28	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.268
3OR7 On the structural basis of modal gating behavior in K+channels - E71I Deposited 2010-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa） Fragment：UNP RESIDUES 22-124	Mutation：E71I	K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate pH 5.0-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.271
3PJS Mechanism of Activation Gating in the Full-Length KcsA K+ Channel Deposited 2010-11-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain K 22–160（139 aa） Chain L 22–160（139 aa） Chain M 22–160（139 aa） Chain N 22–160（139 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.2M Na/K phosphate, 0.1M Bis-Tris propane pH 7.5, 10% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.80 Å R-free 0.332
3STL KcsA potassium channel mutant Y82C with Cadmium bound Deposited 2011-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：Y82C	K POTASSIUM ION × 24 CD CADMIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.263
3STZ KcsA potassium channel mutant Y82C with nitroxide spin label Deposited 2011-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 23–124（102 aa）	Mutation：Y82C	MTN S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate × 4 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；20-25% PEG400, 50mM magnesium acetate, 50mM sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.285
4LBE Structure of KcsA with R122A mutation Deposited 2013-06-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 2–124（123 aa）	Mutation：R122A	F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；PEG 400, MgAcetate, pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.75 Å R-free 0.202
4LCU Structure of KcsA with E118A mutation Deposited 2013-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 2–124（123 aa）	Not recorded	K POTASSIUM ION × 24 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；PEG 400, MgAcetate, pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.75 Å R-free 0.216
4MSW Y78 ester mutant of KcsA in high K+ Deposited 2013-09-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 22–76（55 aa） Fragment：UNP residues 22-124,UNP residues 22-124 Chain C 78–124（47 aa） Fragment：UNP residues 22-124,UNP residues 22-124	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；PEG400, Magnesium acetate, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.06 Å R-free 0.229
4UUJ POTASSIUM CHANNEL KCSA-FAB WITH TETRAHEXYLAMMONIUM Deposited 2014-07-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Not recorded	F09 NONAN-1-OL × 16 IND INDOLE × 4 K POTASSIUM ION × 16 DGA DIACYL GLYCEROL × 4 CO COBALT (II) ION × 4 XA7 TETRAHEXYL AMMONNIUM × 8 PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.4；CRYSTALLIZATION CONDITIONS: 18-25% PEG400, 50 MM SODIUM REMARK 280 ACETATE, 50 MM MAGNESIUM ACETATE, pH 5.4	Resolution 2.40 Å R-free 0.248
5E1A Structure of KcsA with L24C/R117C mutations Deposited 2015-09-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 4–124（121 aa） Fragment：UNP residues 4-124	Mutation：L24C, R117C	K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.75；293 K；PEG 400, MES, Magnesium Acetate	Resolution 3.40 Å R-free 0.257
5EBL KcsA T75G in the Conductive State Deposited 2015-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–125（125 aa） Fragment：UNP residues 1-125	Mutation：T75G	F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；PEG 400	Resolution 2.30 Å R-free 0.242
5EBM KcsA T75G mutant in the nonconductive state Deposited 2015-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–125（125 aa） Fragment：UNP residues 1-125	Mutation：T75G	DGA DIACYL GLYCEROL × 4 F09 NONAN-1-OL × 4 K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；PEG 400	Resolution 2.50 Å R-free 0.251
5EBW KcsA with G77ester mutation Deposited 2015-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–123（123 aa） Fragment：UNP residues 1-123	Mutation：G77(GOA) Non-standard monomer：Yes (specific site not provided by mmCIF)	F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；PEG400	Resolution 2.30 Å R-free 0.249
5EC1 KcsA with V76ester mutation Deposited 2015-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–125（125 aa） Fragment：UNP residues 1-125	Mutation：V76ester Non-standard monomer：Yes (specific site not provided by mmCIF)	F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；PEG400	Resolution 2.75 Å R-free 0.268
5EC2 KcsA with V76ester+G77dA mutations Deposited 2015-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–125（125 aa） Fragment：UNP residues 1-125	Mutation：V76ester,G77dA Non-standard monomer：Yes (specific site not provided by mmCIF)	F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；PEG400	Resolution 2.30 Å R-free 0.259
5J9P KcsA in vitro Deposited 2016-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–117（96 aa） Fragment：UNP residues 22-117	Not recorded	K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG400	Resolution 2.85 Å R-free 0.266
5VK6 Open conformation of KcsA non-inactivating E71A mutant Deposited 2017-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–121（96 aa）	Not recorded	F09 NONAN-1-OL × 4 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4 K POTASSIUM ION × 28	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG400, 50 mM magnesium acetate, 50 mM sodium acetate	Resolution 2.25 Å R-free 0.213
5VKE Open conformation of KcsA deep-inactivated Deposited 2017-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–121（96 aa）	Not recorded	F09 NONAN-1-OL × 4 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4 K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG400, 50 mM magnesium acetate, 50 mM sodium acetate	Resolution 2.37 Å R-free 0.228
5VKH Closed conformation of KcsA Y82A-F103A mutant Deposited 2017-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Not recorded	F09 NONAN-1-OL × 4 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG400 , 50 mM magnesium acetate, 50 mM sodium acetate	Resolution 2.25 Å R-free 0.203
6NFU Structure of the KcsA-G77A mutant or the 2,4-ion bound configuration of a K+ channel selectivity filter. Deposited 2018-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：G77C, L90C	F09 NONAN-1-OL × 4 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG400, magnesium acetate, sodium acetate	Resolution 2.09 Å R-free 0.224
6NFV Structure of the KcsA-G77C mutant or the 2,4-ion bound configuration of a K+ channel selectivity filter. Deposited 2018-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：G77C, L90C	F09 NONAN-1-OL × 4 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG400 , magnesium acetate, sodium acetate	Resolution 2.13 Å R-free 0.243
6PA0 Structure of the G77A mutant in Sodium Chloride Deposited 2019-06-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：G77A, L90C	F09 NONAN-1-OL × 4 DGA DIACYL GLYCEROL × 4 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；22-26 % PEG400 (v/v), 50 mM magnesium acetate, 50 mM sodium acetate (pH 4.8.-5.4)	Resolution 2.05 Å R-free 0.233
6W0A Open-gate KcsA soaked in 1 mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 28–120（93 aa）	Not recorded	BA BARIUM ION × 4 K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 3.24 Å R-free 0.241
6W0B Open-gate KcsA soaked in 2 mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 28–120（93 aa）	Not recorded	BA BARIUM ION × 4 K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 3.60 Å R-free 0.236
6W0C Open-gate KcsA soaked in 4 mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 28–120（93 aa）	Not recorded	BA BARIUM ION × 4 K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 3.56 Å R-free 0.248
6W0D Open-gate KcsA soaked in 5 mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 28–120（93 aa）	Not recorded	BA BARIUM ION × 4 K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 3.64 Å R-free 0.248
6W0E Open-gate KcsA soaked in 10 mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 28–120（93 aa）	Not recorded	BA BARIUM ION × 4 K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 3.51 Å R-free 0.250
6W0F Closed-gate KcsA soaked in 0mM KCl/5mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Not recorded	K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 2.40 Å R-free 0.270
6W0G Closed-gate KcsA soaked in 1mM KCl/5mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：L90C	K POTASSIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 2.60 Å R-free 0.245
6W0H Closed-gate KcsA soaked in 5mM KCl/5mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：L90C	K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 2.60 Å R-free 0.239
6W0I Closed-gate KcsA soaked in 10mM KCl/5mM BaCl2 Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：L90C	K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 2.33 Å R-free 0.232
6W0J Closed-gate KcsA incubated in BaCl2/NaCl Deposited 2020-02-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa）	Mutation：L90C	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；20 % PEG 400, 50 mM Magnesium Acetate, 50 mM Sodium Acetate, pH 5.5	Resolution 2.50 Å R-free 0.218
7M2H Structural Snapshots of Intermediates in the Gating of a K+ Channel Deposited 2021-03-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 3–125（123 aa）	Not recorded	F09 NONAN-1-OL × 4 K POTASSIUM ION × 24 DGA DIACYL GLYCEROL × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.25；293 K；50 mM MES, pH 6.25, 28% PEG400, 50 mM magnesium acetate	Resolution 2.64 Å R-free 0.268
7M2H Structural Snapshots of Intermediates in the Gating of a K+ Channel Deposited 2021-03-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain F 3–125（123 aa）	Not recorded	F09 NONAN-1-OL × 4 K POTASSIUM ION × 24 DGA DIACYL GLYCEROL × 4 TBA TETRABUTYLAMMONIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.25；293 K；50 mM MES, pH 6.25, 28% PEG400, 50 mM magnesium acetate	Resolution 2.64 Å R-free 0.268
7M2I Structural Snapshots of Intermediates in the Gating of a K+ Channel Deposited 2021-03-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–116（91 aa）	Not recorded	F09 NONAN-1-OL × 4 1EM (1S)-2-HYDROXY-1-[(NONANOYLOXY)METHYL]ETHYL MYRISTATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；50 mM MES, pH 6.25, 28% PEG400, 50 mM magnesium acetate	Resolution 2.69 Å R-free 0.251
7M2J Structural Snapshots of Intermediates in the Gating of a K+ Channel Deposited 2021-03-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–116（91 aa）	Not recorded	K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；33% PEG400, 100 mM MES, pH 6.5, 100 mM calcium chloride	Resolution 3.20 Å R-free 0.305
7MDJ The structure of KcsA in complex with a synthetic Fab Deposited 2021-04-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–124（124 aa）	Not recorded	K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；50 mM sodium acetate/50 mM ammonium acetate, 50 mM magnesium acetate, 25% PEG 400.	Resolution 2.75 Å R-free 0.265
7MHR KcsA E71V closed gate with K+ Deposited 2021-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 3–124（122 aa）	Mutation：E71V, L90C	K POTASSIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM sodium acetate pH 5.5, 50 mM magnesium acetate, 25% PEG 400	Resolution 2.77 Å R-free 0.203
7MHX KcsA E71V closed gate with Ba2+ Deposited 2021-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 2–124（123 aa）	Mutation：P2A, E71V, L90C	BA BARIUM ION × 4 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM sodium acetate pH 5.5, 50 mM magnesium acetate, 25% PEG 400	Resolution 2.85 Å R-free 0.244
7MJT KcsA open gate E71V mutant with Barium Deposited 2021-04-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–121（96 aa）	Mutation：A28C, E71V, L90C, R117Q, E118C, E120Q, R121Q	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM sodium/ammonium acetate pH 5.5, 50 mM Magnesium acetate, 25% PG 400	Resolution 3.30 Å R-free 0.270
7MK6 KcsA open gate E71V mutant with sodium Deposited 2021-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–121（96 aa）	Mutation：A28C, E71V, L90C, R117Q, E118C, E120Q, R121Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM sodium/ammonium acetate pH 5.5, 50 mM Magnesium acetate, 25% PEG 400	Resolution 3.10 Å R-free 0.253
7MUB KcsA Open gate E71V mutant in Potassium Deposited 2021-05-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–121（96 aa）	Mutation：A28C, E71V, L90C, R117Q, E118C, E120Q, R121Q	K POTASSIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM Sodium acetate/Ammonium acetate, 50 mM Magnesium acetate, 25% PEG 400	Resolution 3.00 Å R-free 0.260
7RP0 Structural Snapshots of Intermediates in the Gating of a K+ Channel Deposited 2021-08-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 22–124（103 aa） Fragment：UNP residues 22-124	Mutation：Y82A	F09 NONAN-1-OL × 4 K POTASSIUM ION × 16 TBA TETRABUTYLAMMONIUM ION × 4 DGA DIACYL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.25；293 K；50 mM MES, pH 6.25, 50 mM magnesium acetate, 27% PEG400	Resolution 2.48 Å R-free 0.271
8THN KcsA M96V mutant with Y78ester in High K+ Deposited 2023-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 22–124（103 aa）	Mutation：M96V, Y78ester Non-standard monomer：Yes (specific site not provided by mmCIF)	K POTASSIUM ION × 4 TBA TETRABUTYLAMMONIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.25；291 K；27% PEG 400 (v/v), 50 mM magnesium acetate, 50 mM MES pH 6.25	Resolution 2.90 Å R-free 0.276

86 other PDB entries and 96 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCSA_STRLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–97； UniProt 23–119 Author chain B； PDBConstruct 1–97； UniProt 23–119 Author chain C； PDBConstruct 1–97； UniProt 23–119 Author chain D； PDBConstruct 1–97； UniProt 23–119

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1bl8
Deposition date deposition_date	1998-07-23
Structure title title	POTASSIUM CHANNEL (KCSA) FROM STREPTOMYCES LIVIDANS
Keywords keywords	POTASSIUM CHANNEL, INTEGRAL MEMBRANE PROTEIN, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.64 Å
Radius of gyration Rg (electron density) rg_electron	20.58 Å
Forward intensity I(0) i0	21788600.00
Molecular weight molecular_weight	39876.0 kDa
Excluded volume excluded_volume	51698 Å³
Envelope volume envelope_volume	58465 Å³
Hydration-shell volume shell_volume	23381 Å³
Envelope diameter envelope_diameter	66.3 Å
Shell Rg shell_rg	27.49 Å
Envelope Rg envelope_rg	20.84 Å
Shape Rg shape_rg	20.61 Å
Total Rg total_rg	21.46 Å
Total atoms total_atoms	2823
Residues n_residues	388
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	66.5 Å
Rg (real space) rg_real	21.51 Å
Rg uncertainty (real space) rg_real_error	0.31 Å
I(0) (real space) i0_real	2.1790e+07
I(0) uncertainty (real space) i0_real_error	2.5590e+05
Rg (reciprocal space) rg_reciprocal	21.53 Å
I(0) (reciprocal space) i0_reciprocal	21790000.0000
Solution quality estimate total_estimate	0.9087
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	27.8 Å
Skewness Skewness skewness	0.149
Kurtosis Kurtosis kurtosis	-0.475
Angular range angular_range	— – 0.3650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4267000.0000
Real-space data points n_real_points	68
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.945; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.998; Smooth: 0.975

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PROTEIN (POTASSIUM CHANNEL PROTEIN)
Molecular weight formula_weight	10253.0 kDa
Mutation mutation	L90C
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2824

ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ

来源 Source

来源生物 organism	Streptomyces lividans
NCBI Class编号 ncbi_taxonomy_id	1916
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1bl8a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.14 — Gated ion channels
Superfamily Superfamily superfamily	f.14.1 — Voltage-gated ion channels
Family Family family	f.14.1.1 — Voltage-gated potassium channels

Domain ID domain_id	d1bl8b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.14 — Gated ion channels
Superfamily Superfamily superfamily	f.14.1 — Voltage-gated ion channels
Family Family family	f.14.1.1 — Voltage-gated potassium channels

Domain ID domain_id	d1bl8c_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.14 — Gated ion channels
Superfamily Superfamily superfamily	f.14.1 — Voltage-gated ion channels
Family Family family	f.14.1.1 — Voltage-gated potassium channels

Domain ID domain_id	d1bl8d_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.14 — Gated ion channels
Superfamily Superfamily superfamily	f.14.1 — Voltage-gated ion channels
Family Family family	f.14.1.1 — Voltage-gated potassium channels

CATH v4.4 (4 domains)

Domain ID domain_id	1bl8A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1bl8B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1bl8C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1bl8D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	128.780 Å
Unit-cell length b length_b	68.930 Å
Unit-cell length c length_c	112.040 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	124.63 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.2800
R_work r_work	0.2800
R_free r_free	0.2900

fit	/app/data/saxs_computation/bl/1bl8/1bl8.fit
pddf	/app/data/pr_computation/bl/1bl8/1bl8.pr.out
profile	/app/data/saxs_computation/bl/1bl8/1bl8.dat