SAXSdb — 1hjc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RUNT-RELATED TRANSCRIPTION FACTOR 1

MUS MUSCULUS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain A； UniProt 60–182	Fragment：RESIDUES 60-182	;DNA (5'-(GPAPAPCPTPCPTPGPTPGPGP TPTPGPCPG)-3') ; × 1 ;DNA (5'-(CPCPGPCPAPAPCPCPAPCPAP* GPAPGPTPT)-3') ; × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；297 K；0.2 M AMMONIUM ACETATE, 0.15 M MAGNESIUM ACETATE, 5% W/V PEG 4000, 50 MM HEPES BUFFER, PH 7.0 AT 24 DEGREES C	Resolution 2.65 Å R-free 0.263
2	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain D； UniProt 60–182	Fragment：RESIDUES 60-182	;DNA (5'-(GPAPAPCPTPCPTPGPTPGPGP TPTPGPCPG)-3') ; × 1 ;DNA (5'-(CPCPGPCPAPAPCPCPAPCPAP* GPAPGPTPT)-3') ; × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；297 K；0.2 M AMMONIUM ACETATE, 0.15 M MAGNESIUM ACETATE, 5% W/V PEG 4000, 50 MM HEPES BUFFER, PH 7.0 AT 24 DEGREES C	Resolution 2.65 Å R-free 0.263

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1HJC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EAN THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound chloride ions modulate DNA binding Deposited 2001-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–185（140 aa） Fragment：RUNT DOMAIN RESIDUES 46-185	Mutation：YES	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；30% MPEG 350, 5-10% PEG 3350, 70 MM NA CACODYLATE, PH 6.5	Resolution 1.70 Å R-free 0.222
1EAO THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound chloride ions modulate DNA binding Deposited 2001-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–185（140 aa） Fragment：RUNT DOMAIN RESIDUES 46-185	Mutation：YES	BR BROMIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；25 % PEG 3350, 16% GLYCEROL, 130 MM NA CACODYLATE, PH 6.4	Resolution 1.40 Å R-free 0.173
1EAO THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound chloride ions modulate DNA binding Deposited 2001-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 46–185（140 aa） Fragment：RUNT DOMAIN RESIDUES 46-185	Mutation：YES	BR BROMIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；25 % PEG 3350, 16% GLYCEROL, 130 MM NA CACODYLATE, PH 6.4	Resolution 1.40 Å R-free 0.173
1EAQ The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound chloride ions modulate DNA binding Deposited 2001-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–185（140 aa） Fragment：RUNT DOMAIN RESIDUES 36-185	Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；25 % PEG 3350, 16% GLYCEROL, 130 MM NA CACODYLATE, PH 6.4	Resolution 1.25 Å R-free 0.167
1EAQ The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound chloride ions modulate DNA binding Deposited 2001-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 46–185（140 aa） Fragment：RUNT DOMAIN RESIDUES 36-185	Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；25 % PEG 3350, 16% GLYCEROL, 130 MM NA CACODYLATE, PH 6.4	Resolution 1.25 Å R-free 0.167
1HJB CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN AND C/EBPBETA BZIP HOMODIMER BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER Deposited 2001-01-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 60–182（123 aa） Fragment：RESIDUES 60-182	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；297 K；5 MM MGSO4, 3% W/V PEG 4000, 1% V/V DIOXANE, 50 MM MES BUFFER, PH 5.6 AT 24 DEGREES C	Resolution 3.00 Å R-free 0.313
1HJB CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN AND C/EBPBETA BZIP HOMODIMER BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER Deposited 2001-01-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–182（123 aa） Fragment：RESIDUES 60-182	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；297 K；5 MM MGSO4, 3% W/V PEG 4000, 1% V/V DIOXANE, 50 MM MES BUFFER, PH 5.6 AT 24 DEGREES C	Resolution 3.00 Å R-free 0.313
1IO4 CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN-CBFBETA CORE DOMAIN HETERODIMER AND C/EBPBETA BZIP HOMODIMER BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER Deposited 2001-01-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 60–182（123 aa） Fragment：RUNT DOMAIN	Not recorded	AU GOLD ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；297 K；0.2 M potassium chloride, 0.01 M magnesium chloride, 0.01 M DTT, 4.5% V/V PEG 8000, 1% V/V glycerol, 1% V/V MPD, 0.05 M MES buffer pH 5.6, pH 5.60, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 3.00 Å R-free 0.299
2J6W R164N mutant of the RUNX1 Runt domain Deposited 2006-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–185（140 aa） Fragment：RUNT DOMAIN, RESIDUES 46-185	Mutation：YES	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；22% PEG 8000, 0.1M SODIUM CACODYLATE PH=6.5, 0.2M AMMONIUM SULFATE	Resolution 2.60 Å R-free 0.268
2J6W R164N mutant of the RUNX1 Runt domain Deposited 2006-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 46–185（140 aa） Fragment：RUNT DOMAIN, RESIDUES 46-185	Mutation：YES	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；22% PEG 8000, 0.1M SODIUM CACODYLATE PH=6.5, 0.2M AMMONIUM SULFATE	Resolution 2.60 Å R-free 0.268
3WTS Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；10% PEG 4000, 0.1M AMMONIUM ACETATE, 0.05M TRIS HCL, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.279
3WTS Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；10% PEG 4000, 0.1M AMMONIUM ACETATE, 0.05M TRIS HCL, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.279
3WTT Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.277
3WTT Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.277
3WTU Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K, V170A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.282
3WTU Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K, V170A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.282
3WTV Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K, V170G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.284
3WTV Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K, V170G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；4% PEG 8000, 0.1M AMMONIUM ACETATE, 0.02M MAGNESIUM CHLORIDE, 0.05M HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.284
3WTW Crystal structure of the complex comprised of ETS1(K167A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K, K167A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；12% ISOPROPANOL, 0.02M MAGNESIUM CHLORIDE, 0.05M MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.90 Å R-free 0.264
3WTW Crystal structure of the complex comprised of ETS1(K167A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K, K167A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；12% ISOPROPANOL, 0.02M MAGNESIUM CHLORIDE, 0.05M MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.90 Å R-free 0.264
3WTX Crystal structure of the complex comprised of ETS1(Y329A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE PH5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.271
3WTX Crystal structure of the complex comprised of ETS1(Y329A), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；10% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE PH5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.271
3WTY Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；4% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.268
3WTY Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the tcralpha gene enhancer DNA Deposited 2014-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain F 60–263（204 aa） Fragment：UNP RESIDUES 60-263	Mutation：L94K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；298 K；4% PEG 4000, 0.25M AMMONIUM ACETATE, 0.05M SODIUM ACETATE, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.268
3WU1 Crystal structure of the ETS1-RUNX1-DNA ternary complex Deposited 2014-04-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 55–177（123 aa） Fragment：UNP RESIDUES 55-177	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298 K；11% PEG MME 550, 0.1M KCL, 0.015M MGCL2, 0.05M TRIS, pH 7.5, VAPOR DIFFUSION, temperature 298K	Resolution 2.40 Å R-free 0.249
4L0Y Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1) Deposited 2013-06-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 1–242（242 aa） Fragment：UNP residues 1-242	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；298 K；Plate-shaped crystals grown from 100 mM potassium chloride, 15 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 14% v/v PEG550 MME, 6% v/v glycerol, crystal size improved by macroseeding, VAPOR DIFFUSION, temperature 298K	Resolution 2.50 Å R-free 0.245
4L0Z Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 2) Deposited 2013-06-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 1–242（242 aa） Fragment：UNP residues 1-242	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；Square bipyramid-shaped crystals grown from 100 mM potassium chloride, 15 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 14% v/v PEG550 MME, 6% v/v glycerol, crystal size improved by macroseeding, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.70 Å R-free 0.272
4L18 Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3) Deposited 2013-06-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 48–214（167 aa） Fragment：UNP residues 48-214	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；2.5% w/v PEG4000, 5 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 5% v/v glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.280
4L18 Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3) Deposited 2013-06-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain E 48–214（167 aa） Fragment：UNP residues 48-214	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；2.5% w/v PEG4000, 5 mM magnesium chloride hexahydrate, 25 mM MES, pH 5.6, 5% v/v glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.280

17 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AML1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–123； UniProt 60–182 Author chain D； PDBConstruct 1–123； UniProt 60–182

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1hjc
Deposition date deposition_date	2001-01-11
Structure title title	CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER
Keywords keywords	;TRANSCRIPTION/DNA, PROTEIN-DNA COMPLEX, TRANSCRIPTION FACTOR, BZIP, RUNX, RUNT, C/EBP, CBF, CORE BINDING FACTOR, AML1, AML, ONCOPROTEIN, TRANSCRIPTION-DNA complex ;; TRANSCRIPTION/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.16 Å
Radius of gyration Rg (electron density) rg_electron	24.00 Å
Forward intensity I(0) i0	57078100.00
Molecular weight molecular_weight	45537.0 kDa
Excluded volume excluded_volume	51398 Å³
Envelope volume envelope_volume	70198 Å³
Hydration-shell volume shell_volume	25316 Å³
Envelope diameter envelope_diameter	88.1 Å
Shell Rg shell_rg	30.14 Å
Envelope Rg envelope_rg	23.97 Å
Shape Rg shape_rg	23.94 Å
Total Rg total_rg	24.75 Å
Total atoms total_atoms	3126
Residues n_residues	300
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	83.6 Å
Rg (real space) rg_real	25.11 Å
Rg uncertainty (real space) rg_real_error	0.60 Å
I(0) (real space) i0_real	5.7080e+07
I(0) uncertainty (real space) i0_real_error	7.8860e+05
Rg (reciprocal space) rg_reciprocal	25.13 Å
I(0) (reciprocal space) i0_reciprocal	57080000.0000
Solution quality estimate total_estimate	0.8829
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	33.2 Å
Skewness Skewness skewness	0.280
Kurtosis Kurtosis kurtosis	-0.204
Angular range angular_range	— – 0.3150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3336000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.845; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.990; Smooth: 0.950

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	RUNT-RELATED TRANSCRIPTION FACTOR 1
Molecular weight formula_weight	13715.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	3184

GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQK

来源 Source

来源生物 organism	MUS MUSCULUS
通用名 common_name	MOUSE
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	;DNA (5'-(GPAPAPCPTPCPTPGPTPGPGP TPTPGPCPG)-3') ;
Molecular weight formula_weight	4945.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B,E

GAACTCTGTGGTTGCG

Entity 3 Entity 3 polymer

Description description	;DNA (5'-(CPCPGPCPAPAPCPCPAPCPAP* GPAPGPTPT)-3') ;
Molecular weight formula_weight	4852.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,F

CCGCAACCACAGAGTT

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	58

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1hjca_
Class class	b — All beta proteins
Fold Fold fold	b.2 — Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily Superfamily superfamily	b.2.5 — p53-like transcription factors
Family Family family	b.2.5.6 — RUNT domain

Domain ID domain_id	d1hjcd_
Class class	b — All beta proteins
Fold Fold fold	b.2 — Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily Superfamily superfamily	b.2.5 — p53-like transcription factors
Family Family family	b.2.5.6 — RUNT domain

CATH v4.4 (2 domains)

Domain ID domain_id	1hjcA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	720 —

Domain ID domain_id	1hjcD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	720 —

▶

8. Citations (2)

▶

Unit-cell length a length_a	51.094 Å
Unit-cell length b length_b	104.073 Å
Unit-cell length c length_c	116.185 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.650 Å
Low-resolution limit resolution_low	18.010 Å
R factor r_factor	0.2230
R_work r_work	0.2230
R_free r_free	0.2630

fit	/app/data/saxs_computation/hj/1hjc/1hjc.fit
pddf	/app/data/pr_computation/hj/1hjc/1hjc.pr.out
profile	/app/data/saxs_computation/hj/1hjc/1hjc.dat

CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER

1. Protein Identity and Related Structures Protein Identity & Related Structures

RUNT-RELATED TRANSCRIPTION FACTOR 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)