1hz1

RIBONUCLEASE T1 V16A MUTANT IN COMPLEX WITH MG2+

Method: X-RAY DIFFRACTION D_max: 41.7 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RIBONUCLEASE T1

Aspergillus niger

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 22–125	Mutation：V16A	MG MAGNESIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetate, calcium chloride, magnesiusm chrloride (soak), pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å R-free 0.214

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1HZ1	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B2M THREE-DIMENSIONAL STRUCTURE OF RIBONULCEASE T1 COMPLEXED WITH AN ISOSTERIC PHOSPHONATE ANALOGUE OF GPU: ALTERNATE SUBSTRATE BINDING MODES AND CATALYSIS. Deposited 1998-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 27–130（104 aa）	Mutation：GLN 25 VARIANT	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.1；pH 4.10	Resolution 2.00 Å R-free 0.254
1B2M THREE-DIMENSIONAL STRUCTURE OF RIBONULCEASE T1 COMPLEXED WITH AN ISOSTERIC PHOSPHONATE ANALOGUE OF GPU: ALTERNATE SUBSTRATE BINDING MODES AND CATALYSIS. Deposited 1998-11-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: trimeric	Chain B 27–130（104 aa）	Mutation：GLN 25 VARIANT	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.1；pH 4.10	Resolution 2.00 Å R-free 0.254
1BIR RIBONUCLEASE T1, PHE 100 TO ALA MUTANT COMPLEXED WITH 2' GMP Deposited 1996-01-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：F100A	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.240
1BIR RIBONUCLEASE T1, PHE 100 TO ALA MUTANT COMPLEXED WITH 2' GMP Deposited 1996-01-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：F100A	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.240
1BU4 RIBONUCLEASE 1 COMPLEX WITH 2'GMP Deposited 1998-09-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；pH 4.5	Resolution 1.90 Å R-free 0.230
1BVI RIBONUCLEASE T1 (WILDTYPE) COMPLEXED WITH 2'GMP Deposited 1998-09-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 27–130（104 aa） Chain B 27–130（104 aa） Chain C 27–130（104 aa） Chain D 27–130（104 aa）	Not recorded	2GP GUANOSINE-2'-MONOPHOSPHATE × 5 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 47.5 % MPD	Resolution 1.90 Å R-free 0.219
1CH0 RNASE T1 VARIANT WITH ALTERED GUANINE BINDING SEGMENT Deposited 1999-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：Q25K, K41E, Y42F, N43R, Y45W, E46Q	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.7；HANGING DROP CONTAINING 2.5 MG/ML RNASE T1, 2.5 MG/ML 2GMP, 15% PEG MONOMETHYLETHER 5000, 50 MM TRIS/HCL (PH7.7), 50 MM MGCL2, 50 MM CACL2 AGAINST 30 % PEG MONOMETHYLETHER 5000, 100 MM TRIS/HCL (PH7.7), 100 MM MGCL2, 100 MM CACL2	Resolution 2.30 Å R-free 0.241
1CH0 RNASE T1 VARIANT WITH ALTERED GUANINE BINDING SEGMENT Deposited 1999-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：Q25K, K41E, Y42F, N43R, Y45W, E46Q	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.7；HANGING DROP CONTAINING 2.5 MG/ML RNASE T1, 2.5 MG/ML 2GMP, 15% PEG MONOMETHYLETHER 5000, 50 MM TRIS/HCL (PH7.7), 50 MM MGCL2, 50 MM CACL2 AGAINST 30 % PEG MONOMETHYLETHER 5000, 100 MM TRIS/HCL (PH7.7), 100 MM MGCL2, 100 MM CACL2	Resolution 2.30 Å R-free 0.241
1CH0 RNASE T1 VARIANT WITH ALTERED GUANINE BINDING SEGMENT Deposited 1999-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Mutation：Q25K, K41E, Y42F, N43R, Y45W, E46Q	CA CALCIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.7；HANGING DROP CONTAINING 2.5 MG/ML RNASE T1, 2.5 MG/ML 2GMP, 15% PEG MONOMETHYLETHER 5000, 50 MM TRIS/HCL (PH7.7), 50 MM MGCL2, 50 MM CACL2 AGAINST 30 % PEG MONOMETHYLETHER 5000, 100 MM TRIS/HCL (PH7.7), 100 MM MGCL2, 100 MM CACL2	Resolution 2.30 Å R-free 0.241
1DET RIBONUCLEASE T1 CARBOXYMETHYLATED AT GLU 58 IN COMPLEX WITH 2'GMP Deposited 1996-02-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	NA SODIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；pH 4.5	Resolution 1.80 Å
1FYS Ribonuclease T1 V16C mutant Deposited 2000-10-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V16C	CA CALCIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；MPD, Na-acetate, calcium chloride, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.208
1FZU RNAse T1 V78A mutant Deposited 2000-10-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V78A	CA CALCIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；MPD, calcium chloride, sodium acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.198
1G02 Ribonuclease T1 V16S mutant Deposited 2000-10-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V16S	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；MPD, calcium chloride, sodium acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.86 Å R-free 0.210
1GSP RIBONUCLEASE T1 COMPLEXED WITH 2',3'-CGPS, 1 DAY Deposited 1997-11-28	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 SGP GUANOSINE-2',3'-CYCLOPHOSPHOROTHIOATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 2.20 Å R-free 0.206
1HYF RIBONUCLEASE T1 V16A MUTANT IN COMPLEX WITH SR2+ Deposited 2001-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V16A	SR STRONTIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, calcium chloride, acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.70 Å R-free 0.203
1I0V Ribonuclease T1 in complex with 2'GMP (form I crystal) Deposited 2001-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：Q25K	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetaate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.23 Å R-free 0.192
1I0X RIBONUCLEASE T1 IN COMPLEX WITH 2'GMP (FORM II CRYSTAL) Deposited 2001-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：Q25K	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.65 Å R-free 0.216
1I0X RIBONUCLEASE T1 IN COMPLEX WITH 2'GMP (FORM II CRYSTAL) Deposited 2001-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：Q25K	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.65 Å R-free 0.216
1I0X RIBONUCLEASE T1 IN COMPLEX WITH 2'GMP (FORM II CRYSTAL) Deposited 2001-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Mutation：Q25K	2GP GUANOSINE-2'-MONOPHOSPHATE × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.65 Å R-free 0.216
1I0X RIBONUCLEASE T1 IN COMPLEX WITH 2'GMP (FORM II CRYSTAL) Deposited 2001-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 27–130（104 aa）	Mutation：Q25K	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.65 Å R-free 0.216
1I0X RIBONUCLEASE T1 IN COMPLEX WITH 2'GMP (FORM II CRYSTAL) Deposited 2001-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 27–130（104 aa） Chain D 27–130（104 aa）	Mutation：Q25K Mutation：Q25K	2GP GUANOSINE-2'-MONOPHOSPHATE × 3 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, acetate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.65 Å R-free 0.216
1I2E Ribonuclease T1 V16A mutant, form I Deposited 2001-02-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V16A, Q25K	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, calcium chloride, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å R-free 0.209
1I2F Ribonuclease T1 V16A mutant, form II Deposited 2001-02-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V16A, Q25K	CA CALCIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, calcium chloride, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.95 Å R-free 0.205
1I2G Ribonuclease T1 V16T mutant Deposited 2001-02-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V16T, Q25K	CA CALCIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, calcium chloride, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.85 Å R-free 0.197
1I3F Ribonuclease T1 V89S mutant Deposited 2001-02-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V89S, Q25K	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, sodium acetate, calcium chloride, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.35 Å R-free 0.283
1I3I Ribonuclease T1 V78T mutant Deposited 2001-02-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：V78T, Q25K	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD, calcium chloride, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.76 Å R-free 0.202
1LOV X-ray structure of the E58A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate Deposited 2002-05-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：E58A	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD,CaCl2,sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.55 Å R-free 0.199
1LOW X-ray structure of the H40A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate Deposited 2002-05-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：H40A	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD,CaCl2,sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.90 Å R-free 0.229
1LOY X-ray structure of the H40A/E58A mutant of Ribonuclease T1 complexed with 3'-guanosine monophosphate Deposited 2002-05-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：H40A/E58A	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；MPD,CaCl2,sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.55 Å R-free 0.218
1LRA CRYSTALLOGRAPHIC STUDY OF GLU 58 ALA RNASE T1(ASTERISK)2'-GUANOSINE MONOPHOSPHATE AT 1.9 ANGSTROMS RESOLUTION Deposited 1993-10-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	NA SODIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1Q9E RNase T1 variant with adenine specificity Deposited 2003-08-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–104（104 aa）	Mutation：K41E, Y42F, N43R, Y45W, E46N	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；279 K；PEG4000, magnesium chloride, Tris, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 279K, pH 9.00	Resolution 1.70 Å R-free 0.244
1Q9E RNase T1 variant with adenine specificity Deposited 2003-08-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–104（104 aa）	Mutation：K41E, Y42F, N43R, Y45W, E46N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；279 K；PEG4000, magnesium chloride, Tris, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 279K, pH 9.00	Resolution 1.70 Å R-free 0.244
1Q9E RNase T1 variant with adenine specificity Deposited 2003-08-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–104（104 aa）	Mutation：K41E, Y42F, N43R, Y45W, E46N	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；279 K；PEG4000, magnesium chloride, Tris, pH 9, VAPOR DIFFUSION, HANGING DROP, temperature 279K, pH 9.00	Resolution 1.70 Å R-free 0.244
1RGA CRYSTAL STRUCTURE OF RNASE T1 WITH 3'-GMP AND GUANOSINE: A PRODUCT COMPLEX Deposited 1993-06-07	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1 GMP GUANOSINE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.70 Å
1RGC THE COMPLEX BETWEEN RIBONUCLEASE T1 AND 3'-GUANYLIC ACID SUGGESTS GEOMETRY OF ENZYMATIC REACTION PATH. AN X-RAY STUDY Deposited 1993-05-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1RGC THE COMPLEX BETWEEN RIBONUCLEASE T1 AND 3'-GUANYLIC ACID SUGGESTS GEOMETRY OF ENZYMATIC REACTION PATH. AN X-RAY STUDY Deposited 1993-05-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1RGK RNASE T1 MUTANT GLU46GLN BINDS THE INHIBITORS 2'GMP AND 2'AMP AT THE 3' SUBSITE Deposited 1992-02-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2AM ADENOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.87 Å
1RGL RNASE T1 MUTANT GLU46GLN BINDS THE INHIBITORS 2'GMP AND 2'AMP AT THE 3' SUBSITE Deposited 1992-02-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1RHL RIBONUCLEASE T1 COMPLEXED WITH 2'GMP/G23A MUTANT Deposited 1998-10-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：G23A	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；50 MM NAAC PH 4.2 2 MM CACL2 50 % MPD 2MM 2`GMP	Resolution 1.95 Å R-free 0.208
1RLS CRYSTAL STRUCTURE OF RNASE T1 COMPLEXED WITH THE PRODUCT NUCLEOTIDE 3'-GMP. STRUCTURAL EVIDENCE FOR DIRECT INTERACTION OF HISTIDINE 40 AND GLUTAMIC ACID 58 WITH THE 2'-HYDROXYL GROUP OF RIBOSE Deposited 1994-03-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1RN1 THREE-DIMENSIONAL STRUCTURE OF GLN 25-RIBONUCLEASE T1 AT 1.84 ANGSTROMS RESOLUTION: STRUCTURAL VARIATIONS AT THE BASE RECOGNITION AND CATALYTIC SITES Deposited 1991-11-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.84 Å
1RN1 THREE-DIMENSIONAL STRUCTURE OF GLN 25-RIBONUCLEASE T1 AT 1.84 ANGSTROMS RESOLUTION: STRUCTURAL VARIATIONS AT THE BASE RECOGNITION AND CATALYTIC SITES Deposited 1991-11-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.84 Å
1RN1 THREE-DIMENSIONAL STRUCTURE OF GLN 25-RIBONUCLEASE T1 AT 1.84 ANGSTROMS RESOLUTION: STRUCTURAL VARIATIONS AT THE BASE RECOGNITION AND CATALYTIC SITES Deposited 1991-11-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.84 Å
1RN4 HIS92ALA MUTATION IN RIBONUCLEASE T1 INDUCES SEGMENTAL FLEXIBILITY. AN X-RAY STUDY Deposited 1991-11-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
1RNT RESTRAINED LEAST-SQUARES REFINEMENT OF THE CRYSTAL STRUCTURE OF THE RIBONUCLEASE T1(ASTERISK)2(PRIME)-GUANYLIC ACID COMPLEX AT 1.9 ANGSTROMS RESOLUTION Deposited 1987-07-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1TRP X-RAY CRYSTALLOGRAPHIC AND CALORIMERIC STUDIES OF THE EFFECTS OF THE MUTATION TRP 59 TYR IN RIBONUCLEASE T1 Deposited 1993-07-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1TRP X-RAY CRYSTALLOGRAPHIC AND CALORIMERIC STUDIES OF THE EFFECTS OF THE MUTATION TRP 59 TYR IN RIBONUCLEASE T1 Deposited 1993-07-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1TRQ X-RAY CRYSTALLOGRAPHIC AND CALORIMERIC STUDIES OF THE EFFECTS OF THE MUTATION TRP 59 TYR IN RIBONUCLEASE T1 Deposited 1993-07-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1TRQ X-RAY CRYSTALLOGRAPHIC AND CALORIMERIC STUDIES OF THE EFFECTS OF THE MUTATION TRP 59 TYR IN RIBONUCLEASE T1 Deposited 1993-07-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1TTO Crystal structure of the Rnase T1 variant R2 Deposited 2004-06-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–104（104 aa）	Mutation：k41e, y42f, n43r, y45w, e46n, w59y	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；278 K；PEG4000, tris-Cl, calcium chloride, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 278.0K	Resolution 2.10 Å R-free 0.238
1TTO Crystal structure of the Rnase T1 variant R2 Deposited 2004-06-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–104（104 aa）	Mutation：k41e, y42f, n43r, y45w, e46n, w59y	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；278 K；PEG4000, tris-Cl, calcium chloride, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 278.0K	Resolution 2.10 Å R-free 0.238
1TTO Crystal structure of the Rnase T1 variant R2 Deposited 2004-06-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–104（104 aa）	Mutation：k41e, y42f, n43r, y45w, e46n, w59y	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；278 K；PEG4000, tris-Cl, calcium chloride, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 278.0K	Resolution 2.10 Å R-free 0.238
1YGW NMR STRUCTURE OF RIBONUCLEASE T1, 34 STRUCTURES Deposited 1996-09-28	Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Mutation：ISOENZYME WITH LYSINE AT POSITION 25	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；313 K	Resolution not provided
2AAD THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT Deposited 1992-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
2AAD THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT Deposited 1992-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
2AAE THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT Deposited 1992-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
2BIR ADDITIVITY OF SUBSTRATE BINDING IN RIBONUCLEASE T1 (Y42A MUTANT) Deposited 1996-12-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：YES	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.20	Resolution 2.30 Å R-free 0.257
2BU4 RIBONUCLEASE T1 COMPLEX WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NA-ACETATE PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.95 Å R-free 0.249
2GSP RIBONUCLEASE T1/2',3'-CGPS AND 3'-GMP, 2 DAYS Deposited 1997-12-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 SGP GUANOSINE-2',3'-CYCLOPHOSPHOROTHIOATE × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.80 Å R-free 0.197
2HOH RIBONUCLEASE T1 (N9A MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：N9A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 45.0 % MPD	Resolution 1.90 Å R-free 0.209
2HOH RIBONUCLEASE T1 (N9A MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：N9A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 NA SODIUM ION × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 45.0 % MPD	Resolution 1.90 Å R-free 0.209
2HOH RIBONUCLEASE T1 (N9A MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Mutation：N9A	2GP GUANOSINE-2'-MONOPHOSPHATE × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 45.0 % MPD	Resolution 1.90 Å R-free 0.209
2HOH RIBONUCLEASE T1 (N9A MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 27–130（104 aa）	Mutation：N9A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 45.0 % MPD	Resolution 1.90 Å R-free 0.209
2RNT THREE-DIMENSIONAL STRUCTURE OF RIBONUCLEASE T1 COMPLEXED WITH GUANYLYL-2(PRIME),5(PRIME)-GUANOSINE AT 1.8 ANGSTROMS RESOLUTION Deposited 1988-07-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 GPG GUANYLYL-2',5'-PHOSPHOGUANOSINE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
3BIR DISECTING HISTIDINE INTERACTIONS IN RIBONUCLEASE T1 BY ASN AND GLN SUBSTITUTIONS Deposited 1997-06-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：H92N	CA CALCIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；VAPOR DIFFUSION, NAOAC PH 4.2, 20 MG/ML PROTEIN, 45 % MPD 2.5 MM CACL2, 20 MM GPS	Resolution 1.80 Å R-free 0.237
3BU4 RIBONUCLEASE T1 COMPLEX WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NA-ACETATE PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.77 Å R-free 0.249
3GSP RIBONUCLEASE T1 COMPLEXED WITH 2',3'-CGPS + 3'-GMP, 4 DAYS Deposited 1997-12-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 SGP GUANOSINE-2',3'-CYCLOPHOSPHOROTHIOATE × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.90 Å R-free 0.209
3HOH RIBONUCLEASE T1 (THR93GLN MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：T93Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 42.5 % MPD	Resolution 1.95 Å R-free 0.213
3HOH RIBONUCLEASE T1 (THR93GLN MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：T93Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 42.5 % MPD	Resolution 1.95 Å R-free 0.213
3HOH RIBONUCLEASE T1 (THR93GLN MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Mutation：T93Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 42.5 % MPD	Resolution 1.95 Å R-free 0.213
3HOH RIBONUCLEASE T1 (THR93GLN MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 27–130（104 aa）	Mutation：T93Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；25 MM NAAC PH 4.2 6.25 MM CACL2 42.5 % MPD	Resolution 1.95 Å R-free 0.213
3RNT CRYSTAL STRUCTURE OF GUANOSINE-FREE RIBONUCLEASE T1, COMPLEXED WITH VANADATE(V), SUGGESTS CONFORMATIONAL CHANGE UPON SUBSTRATE BINDING Deposited 1989-05-31	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 VO4 VANADATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
3SYU Re-refined coordinates for pdb entry 1det - ribonuclease T1 carboxymethylated at GLU 58 in complex with 2'GMP Deposited 2011-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	NA SODIUM ION × 2 2GP GUANOSINE-2'-MONOPHOSPHATE × 1 UNX UNKNOWN LIGAND × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.95 Å R-free 0.165
3URP Re-refinement of PDB entry 5RNT - ribonuclease T1 with guanosine-3',5'-diphosphate and phosphate ion bound Deposited 2011-11-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	PGP GUANOSINE-3',5'-DIPHOSPHATE × 1 PO4 PHOSPHATE ION × 1 UNX UNKNOWN LIGAND × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.19 Å R-free 0.237
4BIR RIBONUCLEASE T1: FREE HIS92GLN MUTANT Deposited 1998-01-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：H92Q	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.2	Resolution 1.70 Å
4BU4 RIBONUCLEASE T1 COMPLEX WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NA-ACETATE PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.80 Å R-free 0.253
4GSP RIBONUCLEASE T1 COMPLEXED WITH 2',3'-CGPS + 3'-GMP, 7 DAYS Deposited 1997-12-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1 SGP GUANOSINE-2',3'-CYCLOPHOSPHOROTHIOATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.65 Å R-free 0.197
4HOH RIBONUCLEASE T1 (THR93ALA MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.20	Resolution 2.05 Å R-free 0.234
4HOH RIBONUCLEASE T1 (THR93ALA MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.20	Resolution 2.05 Å R-free 0.234
4HOH RIBONUCLEASE T1 (THR93ALA MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Mutation：T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.20	Resolution 2.05 Å R-free 0.234
4HOH RIBONUCLEASE T1 (THR93ALA MUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 27–130（104 aa）	Mutation：T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；pH 4.20	Resolution 2.05 Å R-free 0.234
4ODK Structure of SlyD from Thermus thermophilus in complex with T1 peptide Deposited 2014-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 59–73（15 aa） Fragment：T1 peptide (UNP residues 59-73) Chain C 59–73（15 aa） Fragment：T1 peptide (UNP residues 59-73)	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；13.2% PEG1500, 0.1 M HEPES, pH 7.5, 0.05 M sodium chloride, 11% glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.40 Å R-free 0.167
4RNT HIS 92 ALA MUTATION IN RIBONUCLEASE T1 INDUCES SEGMENTAL FLEXIBILITY. AN X-RAY STUDY Deposited 1990-02-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
5BIR DISECTING HISTIDINE INTERACTIONS IN RIBONUCLEASE T1 USING ASN AND GLN MUTATIONS Deposited 1997-06-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：H92Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；VAPOR DIFFUSION, HANGING DROP, 20 MG/ML PROTEIN NAOAC BUF. PH 4.2, 0.125 % 2'GMP, 1.25 % CACL2, 47.5 % MPD, vapor diffusion - hanging drop	Resolution 2.00 Å R-free 0.255
5BIR DISECTING HISTIDINE INTERACTIONS IN RIBONUCLEASE T1 USING ASN AND GLN MUTATIONS Deposited 1997-06-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：H92Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；VAPOR DIFFUSION, HANGING DROP, 20 MG/ML PROTEIN NAOAC BUF. PH 4.2, 0.125 % 2'GMP, 1.25 % CACL2, 47.5 % MPD, vapor diffusion - hanging drop	Resolution 2.00 Å R-free 0.255
5BIR DISECTING HISTIDINE INTERACTIONS IN RIBONUCLEASE T1 USING ASN AND GLN MUTATIONS Deposited 1997-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 27–130（104 aa）	Mutation：H92Q	2GP GUANOSINE-2'-MONOPHOSPHATE × 2 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；VAPOR DIFFUSION, HANGING DROP, 20 MG/ML PROTEIN NAOAC BUF. PH 4.2, 0.125 % 2'GMP, 1.25 % CACL2, 47.5 % MPD, vapor diffusion - hanging drop	Resolution 2.00 Å R-free 0.255
5BU4 RIBONUCLEASE T1 COMPLEX WITH 2'GMP Deposited 1998-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NA-ACETATE PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.77 Å R-free 0.225
5GSP RIBONUCLEASE T1/3'-GMP, 9 WEEKS Deposited 1997-12-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 1.80 Å R-free 0.202
5HOH RIBONUCLEASE T1 (ASN9ALA/THR93ALA DOUBLEMUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Mutation：N9A,T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；25 MM NAAC PH 4.2 6.25 MM CACL2 40.0 % MPD, pH 7.5	Resolution 2.00 Å R-free 0.212
5HOH RIBONUCLEASE T1 (ASN9ALA/THR93ALA DOUBLEMUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 27–130（104 aa）	Mutation：N9A,T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；25 MM NAAC PH 4.2 6.25 MM CACL2 40.0 % MPD, pH 7.5	Resolution 2.00 Å R-free 0.212
5HOH RIBONUCLEASE T1 (ASN9ALA/THR93ALA DOUBLEMUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 27–130（104 aa）	Mutation：N9A,T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；25 MM NAAC PH 4.2 6.25 MM CACL2 40.0 % MPD, pH 7.5	Resolution 2.00 Å R-free 0.212
5HOH RIBONUCLEASE T1 (ASN9ALA/THR93ALA DOUBLEMUTANT) COMPLEXED WITH 2'GMP Deposited 1998-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 27–130（104 aa）	Mutation：N9A,T93A	2GP GUANOSINE-2'-MONOPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；25 MM NAAC PH 4.2 6.25 MM CACL2 40.0 % MPD, pH 7.5	Resolution 2.00 Å R-free 0.212
5RNT X-RAY ANALYSIS OF CUBIC CRYSTALS OF THE COMPLEX FORMED BETWEEN RIBONUCLEASE T1 AND GUANOSINE-3',5'-BISPHOSPHATE Deposited 1991-03-28	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	PGP GUANOSINE-3',5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.20 Å
6GSP RIBONUCLEASE T1/3'-GMP, 15 WEEKS Deposited 1997-12-09	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 3GP GUANOSINE-3'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 2.20 Å R-free 0.217
6RNT CRYSTAL STRUCTURE OF RIBONUCLEASE T1 COMPLEXED WITH ADENOSINE 2'-MONOPHOSPHATE AT 1.8-ANGSTROMS RESOLUTION Deposited 1991-08-20	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1 2AM ADENOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
7GSP RIBONUCLEASE T1/2',3'-CGPS, NON-PRODUCTIVE Deposited 1997-12-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	PO4 PHOSPHATE ION × 1 SGP GUANOSINE-2',3'-CYCLOPHOSPHOROTHIOATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 2.00 Å R-free 0.228
7GSP RIBONUCLEASE T1/2',3'-CGPS, NON-PRODUCTIVE Deposited 1997-12-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 22–125（104 aa）	Not recorded	PO4 PHOSPHATE ION × 1 SGP GUANOSINE-2',3'-CYCLOPHOSPHOROTHIOATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.2；20 MM NAAC PH 4.2 2 MM CACL2 55 % MPD	Resolution 2.00 Å R-free 0.228
7RNT CRYSTAL STRUCTURE OF THE TYR45TRP MUTANT OF RIBONUCLEASE T1 IN A COMPLEX WITH 2'-ADENYLIC ACID Deposited 1991-08-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–130（104 aa）	Not recorded	CA CALCIUM ION × 1 2AM ADENOSINE-2'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
8RNT STRUCTURE OF RIBONUCLEASE T1 COMPLEXED WITH ZINC(II) AT 1.8 ANGSTROMS RESOLUTION: A ZN2+.6H2O.CARBOXYLATE CLATHRATE Deposited 1991-09-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
9RNT RIBONUCLEASE T1 WITH FREE RECOGNITION AND CATALYTIC SITE: CRYSTAL STRUCTURE ANALYSIS AT 1.5 ANGSTROMS RESOLUTION Deposited 1991-09-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22–125（104 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å

67 other PDB entries and 100 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RNT1_ASPOR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–104； UniProt 22–125

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1hz1
Deposition date deposition_date	2001-01-23
Structure title title	RIBONUCLEASE T1 V16A MUTANT IN COMPLEX WITH MG2+
Keywords keywords	ribonuclease, metal binding, stability, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	13.78 Å
Radius of gyration Rg (electron density) rg_electron	12.36 Å
Forward intensity I(0) i0	3277620.00
Molecular weight molecular_weight	11439.0 kDa
Excluded volume excluded_volume	13660 Å³
Envelope volume envelope_volume	15262 Å³
Hydration-shell volume shell_volume	10504 Å³
Envelope diameter envelope_diameter	40.0 Å
Shell Rg shell_rg	18.10 Å
Envelope Rg envelope_rg	12.64 Å
Shape Rg shape_rg	12.30 Å
Total Rg total_rg	13.65 Å
Total atoms total_atoms	804
Residues n_residues	104
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	41.7 Å
Rg (real space) rg_real	13.66 Å
Rg uncertainty (real space) rg_real_error	0.18 Å
I(0) (real space) i0_real	3.2780e+06
I(0) uncertainty (real space) i0_real_error	3.7130e+04
Rg (reciprocal space) rg_reciprocal	13.67 Å
I(0) (reciprocal space) i0_reciprocal	3278000.0000
Solution quality estimate total_estimate	0.7287
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	40.6 Å
Skewness Skewness skewness	0.025
Kurtosis Kurtosis kurtosis	-0.467
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	768000.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.907; Stabil: 1.000; Sysdev: 0.256; Positv: 1.000; Valcen: 0.981; Smooth: 0.997

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	RIBONUCLEASE T1
Molecular weight formula_weight	11066.6 kDa
EC 编号 ec_number	3.1.27.3
Mutation mutation	V16A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	888

ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT

来源 Source

来源生物 organism	Aspergillus niger
NCBI Class编号 ncbi_taxonomy_id	5061
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	GUANOSINE-2'-MONOPHOSPHATE
Molecular weight formula_weight	363.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	84

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1hz1a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.1 — Microbial ribonucleases
Superfamily Superfamily superfamily	d.1.1 — Microbial ribonucleases
Family Family family	d.1.1.4 — Fungal ribonucleases

CATH v4.4 (1 domains)

Domain ID domain_id	1hz1A00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	450 — Nuclear Transport Factor 2; Chain: A,
Homologous superfamily homologous superfamily	30 — Microbial ribonucleases

▶

8. Citations (1)

▶

Unit-cell length a length_a	40.515 Å
Unit-cell length b length_b	47.289 Å
Unit-cell length c length_c	50.023 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.1978
R_work r_work	0.1964
R_free r_free	0.2144

fit	/app/data/saxs_computation/hz/1hz1/1hz1.fit
pddf	/app/data/pr_computation/hz/1hz1/1hz1.pr.out
profile	/app/data/saxs_computation/hz/1hz1/1hz1.dat