1qjh

Protein Aggregation and Alzheimer's Disease: Crystallographic Analysis of the Phenomenon. Engineered version of the ribosomal protein S6 used as a stable scaffold to study oligomerization.

Method: X-RAY DIFFRACTION D_max: 46.1 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S6

Thermus thermophilus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–101	Mutation：YES	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7；pH 7.00	Resolution 2.20 Å R-free 0.275

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1QJH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CQM PROTEIN AGGREGATION AND ALZHEIMER'S DISEASE: CRYSTALLOGRAPHIC ANALYSIS OF THE PHENOMENON. ENGINEERED VERSION OF THE RIBOSOMAL PROTEIN S6 USED AS A STABLE SCAFFOLD TO STUDY OLIGOMERIZATION. Deposited 1999-08-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–101（101 aa）	Mutation：E41A, E42I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；PEG 400, SODIUM CITRATE, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 20K	Resolution 1.65 Å R-free 0.253
1CQM PROTEIN AGGREGATION AND ALZHEIMER'S DISEASE: CRYSTALLOGRAPHIC ANALYSIS OF THE PHENOMENON. ENGINEERED VERSION OF THE RIBOSOMAL PROTEIN S6 USED AS A STABLE SCAFFOLD TO STUDY OLIGOMERIZATION. Deposited 1999-08-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–101（101 aa）	Mutation：E41A, E42I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；PEG 400, SODIUM CITRATE, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 20K	Resolution 1.65 Å R-free 0.253
1CQN PROTEIN AGGREGATION AND ALZHEIMER'S DISEASE: CRYSTALLOGRAPHIC ANALYSIS OF THE PHENOMENON. ENGINEERED VERSION OF THE RIBOSOMAL PROTEIN S6 USED AS A STABLE SCAFFOLD TO STUDY OLIGOMERIZATION. Deposited 1999-08-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–101（101 aa）	Mutation：E41A, E42I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；PEG 400, SODIUM CITRATE, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 20K	Resolution 2.10 Å R-free 0.276
1CQN PROTEIN AGGREGATION AND ALZHEIMER'S DISEASE: CRYSTALLOGRAPHIC ANALYSIS OF THE PHENOMENON. ENGINEERED VERSION OF THE RIBOSOMAL PROTEIN S6 USED AS A STABLE SCAFFOLD TO STUDY OLIGOMERIZATION. Deposited 1999-08-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–101（101 aa）	Mutation：E41A, E42I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；PEG 400, SODIUM CITRATE, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 20K	Resolution 2.10 Å R-free 0.276
1EG0 FITTING OF COMPONENTS WITH KNOWN STRUCTURE INTO AN 11.5 A CRYO-EM MAP OF THE E.COLI 70S RIBOSOME Deposited 2000-02-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 11 PDB declaration: pentadecameric	Chain C 1–97（97 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6；20 mM Hepes, 6 mM Mg(CH3COO)2 150 mM NH4Cl, 4 mM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.50 Å
1FJG STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH THE ANTIBIOTICS STREPTOMYCIN, SPECTINOMYCIN, AND PAROMOMYCIN Deposited 2000-08-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 96 SCM SPECTINOMYCIN × 1 SRY STREPTOMYCIN × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, NH4Cl, KCl, CaCl2, magnesium acetate, sodium cacodylate, streptomycin, paromomycin, spectinomycin, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.00 Å R-free 0.255
1FKA STRUCTURE OF FUNCTIONALLY ACTIVATED SMALL RIBOSOMAL SUBUNIT AT 3.3 A RESOLUTION Deposited 2000-08-09	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: eicosameric	Chain F 1–101（101 aa）	Not recorded	WO2 OCTADECATUNGSTENYL DIPHOSPHATE × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.7；291 K；MPD, Spermidine, MgCl2, NH4Cl, pH 7.7, VAPOR DIFFUSION, HANGING DROP, temperature 291.0K	Resolution 3.30 Å R-free 0.305
1HNW STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH TETRACYCLINE Deposited 2000-12-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 96 TAC TETRACYCLINE × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；VAPOR DIFFUSION, HANGING DROP at 277 K. MPD, NH4CL, KCL, CACL2, MAGNESIUM ACETATE, SODIUM CACODYLATE, pH 6.5. 80 mM tetracycline soaked into preformed crystals., pH 6.50	Resolution 3.40 Å R-free 0.264
1HNX STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH PACTAMYCIN Deposited 2000-12-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 96 PCY Pactamycin × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；VAPOR DIFFUSION, HANGING DROP AT 277 K. MPD, NH4CL, KCL, CACL2, MAGNESIUM ACETATE, SODIUM CACODYLATE, pH 6.50. 80 uM Pactamycin soaked into preformed crystals.	Resolution 3.40 Å R-free 0.280
1HNZ STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH HYGROMYCIN B Deposited 2000-12-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 96 HYG HYGROMYCIN B × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；VAPOR DIFFUSION, HANGING DROP at 277 K. MPD, NH4CL, KCL, CACL2, MAGNESIUM ACETATE, SODIUM CACODYLATE, pH 6.50. 80 uM HYGROMYCIN B soaked into preformed crystals.	Resolution 3.30 Å R-free 0.261
1HR0 CRYSTAL STRUCTURE OF INITIATION FACTOR IF1 BOUND TO THE 30S RIBOSOMAL SUBUNIT Deposited 2000-12-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 21 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 65 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；15% MPD, 25 mM magnesium Acetate, 200 mM KCl, 75 mM NH4Cl, 100 mM K-Cacodylate, pH 6.50. VAPOR DIFFUSION, HANGING DROP at 277 K Initiation factor 1 soaked into pre-formed crystals.	Resolution 3.20 Å R-free 0.261
1I94 CRYSTAL STRUCTURES OF THE SMALL RIBOSOMAL SUBUNIT WITH TETRACYCLINE, EDEINE AND IF3 Deposited 2001-03-18	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 75 WO2 OCTADECATUNGSTENYL DIPHOSPHATE × 14 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；291 K；MPD, magnesium chloride, spermidine, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 291.K	Resolution 3.20 Å R-free 0.245
1I95 CRYSTAL STRUCTURE OF THE 30S RIBOSOMAL SUBUNIT FROM THERMUS THERMOPHILUS IN COMPLEX WITH EDEINE Deposited 2001-03-18	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 75 WO2 OCTADECATUNGSTENYL DIPHOSPHATE × 14 EDE EDEINE B × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；291 K；MPD, magnesium chloride, spermidine, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 291.K	Resolution 4.50 Å R-free 0.244
1I96 CRYSTAL STRUCTURE OF THE 30S RIBOSOMAL SUBUNIT FROM THERMUS THERMOPHILUS IN COMPLEX WITH THE TRANSLATION INITIATION FACTOR IF3 (C-TERMINAL DOMAIN) Deposited 2001-03-18	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 21 PDB declaration: 22-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 75 WO2 OCTADECATUNGSTENYL DIPHOSPHATE × 12 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；291 K；MPD, magnesium chloride, spermidine, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 291.K	Resolution 4.20 Å R-free 0.264
1I97 CRYSTAL STRUCTURE OF THE 30S RIBOSOMAL SUBUNIT FROM THERMUS THERMOPHILUS IN COMPLEX WITH TETRACYCLINE Deposited 2001-03-18	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 75 WO2 OCTADECATUNGSTENYL DIPHOSPHATE × 14 TAC TETRACYCLINE × 6 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；291 K；MPD, magnesium chloride, spermidine, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 291.K	Resolution 4.50 Å R-free 0.254
1IBK STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH THE ANTIBIOTIC PAROMOMYCIN Deposited 2001-03-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 113 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, AMMONIUM CHLORIDE, POTASSIUM CHLORIDE, MAGNESIUM ACETATE, SODIUM CACODYLATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 277K, pH 6.50	Resolution 3.31 Å R-free 0.282
1IBL STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH A MESSENGER RNA FRAGMENT AND COGNATE TRANSFER RNA ANTICODON STEM-LOOP BOUND AT THE A SITE AND WITH THE ANTIBIOTIC PAROMOMYCIN Deposited 2001-03-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 125 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, AMMONIUM CHLORIDE, POTASSIUM CHLORIDE, MAGNESIUM ACETATE, SODIUM CACODYLATE, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 277K, pH 6.50	Resolution 3.11 Å R-free 0.275
1IBM STRUCTURE OF THE THERMUS THERMOPHILUS 30S RIBOSOMAL SUBUNIT IN COMPLEX WITH A MESSENGER RNA FRAGMENT AND COGNATE TRANSFER RNA ANTICODON STEM-LOOP BOUND AT THE A SITE Deposited 2001-03-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 120 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, AMMONIUM CHLORIDE, POTASSIUM CHLORIDE, MAGNESIUM ACETATE, SODIUM CACODYLATE pH 6.5, VAPOR DIFFUSION, HANGING DROP at 277K, pH 6.50	Resolution 3.31 Å R-free 0.286
1J5E Structure of the Thermus thermophilus 30S Ribosomal Subunit Deposited 2002-04-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	UNX UNKNOWN LIGAND × 188 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, NH4Cl, KCl, CaCl2, magnesium acetate, sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.05 Å R-free 0.252
1LOU RIBOSOMAL PROTEIN S6 Deposited 1998-11-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–101（101 aa）	Mutation：L30A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 1.95 Å R-free 0.247
1N32 Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position at the a site with paromomycin Deposited 2002-10-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 158 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, NH4Cl, KCl, CaCl2, magnesium acetate, potassium-MES, sodium cacodylate, PH 6.5, VAPOR DIFFUSION, HANGING DROP AT 277K	Resolution 3.00 Å R-free 0.270
1N33 Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin Deposited 2002-10-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 106 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, NH4Cl, KCl, CaCl2, magnesium acetate, potassium-MES, sodium cacodylate, PH 6.5, VAPOR DIFFUSION, HANGING DROP AT 277K	Resolution 3.35 Å R-free 0.284
1QD7 PARTIAL MODEL FOR 30S RIBOSOMAL SUBUNIT Deposited 1999-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 8 PDB declaration: decameric	Chain E 1–97（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277 K；VAPOUR DIFFUSION AT 277 K, MPD, VAPOR DIFFUSION	Resolution 5.50 Å
1RIS CRYSTAL STRUCTURE OF THE RIBOSOMAL PROTEIN S6 FROM THERMUS THERMOPHILUS Deposited 1994-05-31	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–101（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1XMO Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center Deposited 2004-10-04	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 107 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, magnesium chloride, potassium chloride, ammonium chloride, MES-KOH, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.K	Resolution 3.25 Å R-free 0.284
1XMQ Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center Deposited 2004-10-04	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 107 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, magnesium chloride, potassium chloride, ammonium chloride, MES-KOH, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.K	Resolution 3.00 Å R-free 0.236
1XNQ Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center Deposited 2004-10-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 107 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, magnesium chloride, potassium chloride, ammonium chloride, MES-KOH, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.K	Resolution 3.05 Å R-free 0.270
1XNR Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center Deposited 2004-10-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 MG MAGNESIUM ION × 108 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；MPD, magnesium chloride, potassium chloride, ammonium chloride, MES-KOH, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.K	Resolution 3.10 Å R-free 0.273
2BVZ Mutant of the Ribosomal Protein S6 Deposited 2005-07-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–101（101 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M NA-CITRATE, 0.1M TRIS-CL PH 8.5, 17.5% (V/V) PEG400	Resolution 2.20 Å R-free 0.222
2BXJ Double Mutant of the Ribosomal Protein S6 Deposited 2005-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–101（101 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M NA-CITRATE, 0.1M TRIS-CL PH 8.5, 25% (V/V) PEG400	Resolution 2.40 Å R-free 0.236
2BXJ Double Mutant of the Ribosomal Protein S6 Deposited 2005-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–101（101 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2M NA-CITRATE, 0.1M TRIS-CL PH 8.5, 25% (V/V) PEG400	Resolution 2.40 Å R-free 0.236
2F4V 30S ribosome + designer antibiotic Deposited 2005-11-24	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 19 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 101 K POTASSIUM ION × 12 D2C (2S,4S,4AR,5AS,6S,11R,11AS,12R,12AR)-7-CHLORO-4-(DIMETHYLAMINO)-6,10,11,12-TETRAHYDROXY-1,3-DIOXO-1,2,3,4,4A,5,5A,6,11,11A,12,12A-DODECAHYDROTETRACENE-2-CARBOXAMIDE × 1 AB9 (2R)-4-AMINO-N-{(1R,2S,3R,4R,5S)-5-AMINO-2-{2-[(2-AMINOETHYL)AMINO]ETHOXY}-4-[(2,6-DIAMINO-2,6-DIDEOXY-ALPHA-D-GLUCOPYRANOSYL)OXY]-3-HYDROXYCYCLOHEXYL}-2-HYDROXYBUTANAMIDE × 1 ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.80 Å R-free 0.315
2HHH Crystal structure of kasugamycin bound to the 30S ribosomal subunit Deposited 2006-06-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	KSG (1S,2R,3S,4R,5S,6S)-2,3,4,5,6-PENTAHYDROXYCYCLOHEXYL 2-AMINO-4-{[CARBOXY(IMINO)METHYL]AMINO}-2,3,4,6-TETRADEOXY-ALPHA-D-ARABINO-HEXOPYRANOSIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；300 K；MPD, MAGNESIUM CHLORIDE, POTASSIUM CHLORIDE, AMMONIUM CHLORIDE, MES-KOH, pH 6.50, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 3.35 Å R-free 0.289
2KJV Solution structure and backbone dynamics of the ribosomal protein S6wt Deposited 2009-06-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–101（101 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；298 K；Pressure ambient NMR sample composition 0.8-1.2 mM [U-15N] protein, 20 mM MES, 50 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.8-1.2 mM protein, 50 mM sodium chloride, 100% D2O \| 100% D2O	Resolution not provided
2KJW Solution structure and backbone dynamics of the permutant P54-55 Deposited 2009-06-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 55–91（37 aa） Chain A 3–54（52 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；298 K；Pressure ambient NMR sample composition 0.8-1.2 mM [U-15N] entity-1, 20 mM MES-2, 50 mM sodium chloride-3, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.8-1.2 mM entity-4, 50 mM sodium chloride-5, 100% D2O \| 100% D2O NMR sample composition 0.8-1.2 mM [U-13C; U-15N] entity-6, 20 mM MES-7, 50 mM sodium chloride-8, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
3OTO Crystal Structure of the 30S ribosomal subunit from a KsgA mutant of Thermus thermophilus (HB8) Deposited 2010-09-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 21-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 94 K POTASSIUM ION × 42 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 6.5；277 K；pH 6.5, hanging drop, temperature 277K	Resolution 3.69 Å R-free 0.231
3ZZP Circular permutant of ribosomal protein S6, lacking edge strand beta- 2 of wild-type S6. Deposited 2011-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 55–93（39 aa） Fragment：RESIDUES 3-35,55-93 Chain A 3–35（33 aa） Fragment：RESIDUES 3-35,55-93	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；1.9M AMMONIUM SULPHATE, 0.1M MES PH 6.5, 8% 1,4 DIOXANE	Resolution 0.96 Å R-free 0.137
4AQY Structure of ribosome-apramycin complexes Deposited 2012-04-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 20 PDB declaration: 23-meric	Chain F 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 203 K POTASSIUM ION × 15 AM2 APRAMYCIN × 5 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；MPD, NH4CL, KCL, CACL2, MAGNESIUM ACETATE, SODIUM CACODYLATE, PH 6.5, VAPOR DIFFUSION, HANGING DROP AT 277K	Resolution 3.50 Å R-free 0.235
4V4R Crystal structure of the whole ribosomal complex. Deposited 2005-09-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 56-meric	Chain AF 1–101（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.7；277 K；PEG20k, MES buffer, magnesium acetate, potassium chloride, ammonium chloride, pH 6.7, VAPOR DIFFUSION, temperature 277K	Resolution 5.90 Å R-free 0.371
4V4S Crystal structure of the whole ribosomal complex. Deposited 2005-10-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 56-meric	Chain AF 1–101（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.7；277 K；PEG20k, MES buffer, magnesium acetate, potassium chloride, ammonium chloride, pH 6.7, VAPOR DIFFUSION, temperature 277K	Resolution 6.76 Å R-free 0.356
4V4T Crystal structure of the whole ribosomal complex with a stop codon in the A-site. Deposited 2005-10-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 55-meric	Chain AF 1–101（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.7；277 K；PEG20k, MES buffer, magnesium acetate, potassium chloride, ammonium chloride, pH 6.7, VAPOR DIFFUSION, temperature 277K	Resolution 6.46 Å R-free 0.361
4V4Y Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. Deposited 2006-06-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 57-meric	Chain AI 1–101（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；MPD, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 5.50 Å R-free 0.326
4V4Z 70S Thermus thermophilous ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. Deposited 2006-06-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 56-meric	Chain AI 1–101（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；MPD, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 4.51 Å R-free 0.345
4V5L The structure of EF-Tu and aminoacyl-tRNA bound to the 70S ribosome with a GTP analog Deposited 2010-09-02	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 59-meric	Chain AF 1–101（101 aa）	Not recorded	PAR PAROMOMYCIN × 1 ZN ZINC ION × 4 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.3；100 MM MES PH 6.3, 60-100 MM KCL, 50 MM SUCROSE, 1% GLYCEROL, AND 5.3% (W/V) PEG20K	Resolution 3.10 Å R-free 0.268
4V7J Structure of RelE nuclease bound to the 70S ribosome (precleavage state) Deposited 2009-11-02	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 52 PDB declaration: 58-meric	Chain Af 1–101（101 aa）	Not recorded	ZN ZINC ION × 4 MG MAGNESIUM ION × 532	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；0.1M Tris-HAc, 0.2M KSCN, 3-4.5% w/v PEG 20k, 3-4.5% PEG 550 monomethylether, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.247
4V7J Structure of RelE nuclease bound to the 70S ribosome (precleavage state) Deposited 2009-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 52 PDB declaration: 58-meric	Chain not uniquely mapped Reference range not declared	Not recorded	ZN ZINC ION × 4 MG MAGNESIUM ION × 532	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；0.1M Tris-HAc, 0.2M KSCN, 3-4.5% w/v PEG 20k, 3-4.5% PEG 550 monomethylether, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.30 Å R-free 0.247
4V8X Structure of Thermus thermophilus ribosome Deposited 2013-07-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 53 PDB declaration: 59-meric	Chain AF 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 352 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；0.1 M TRIS-HAC PH 7.2, 0.2 M KSCN, 4.1%-4.3% (W/V) PEG 20K AND 4.1%-4.3% (W/V) PEG 550MME	Resolution 3.35 Å R-free 0.261
4V8X Structure of Thermus thermophilus ribosome Deposited 2013-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 53 PDB declaration: 59-meric	Chain not uniquely mapped Reference range not declared	Not recorded	MG MAGNESIUM ION × 355 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；0.1 M TRIS-HAC PH 7.2, 0.2 M KSCN, 4.1%-4.3% (W/V) PEG 20K AND 4.1%-4.3% (W/V) PEG 550MME	Resolution 3.35 Å R-free 0.261
4WR6 Complex of 70S ribosome with tRNA-Tyr and mRNA with A-A mismatch in the first position in the A-site. Deposited 2014-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 47 PDB declaration: 54-MERIC	Chain 5E 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 652 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.05 Å R-free 0.249
4WR6 Complex of 70S ribosome with tRNA-Tyr and mRNA with A-A mismatch in the first position in the A-site. Deposited 2014-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 47 PDB declaration: 54-MERIC	Chain 52 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 508 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.05 Å R-free 0.249
4WRA Complex of 70S ribosome with tRNA-Tyr and mRNA with A-A mismatch in the first position in the A-site and with antibiotic paromomycin. Deposited 2014-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 47 PDB declaration: 54-MERIC	Chain 5E 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 661 PAR PAROMOMYCIN × 1 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.05 Å R-free 0.249
4WRA Complex of 70S ribosome with tRNA-Tyr and mRNA with A-A mismatch in the first position in the A-site and with antibiotic paromomycin. Deposited 2014-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 47 PDB declaration: 54-MERIC	Chain 52 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 497 PAR PAROMOMYCIN × 1 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.05 Å R-free 0.249
4WU1 Complex of 70S ribosome with tRNA-Tyr and mRNA with G-U mismatch in the second position in the P-site Deposited 2014-10-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 48 PDB declaration: 54-meric	Chain 5E 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 708 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.20 Å R-free 0.238
4WU1 Complex of 70S ribosome with tRNA-Tyr and mRNA with G-U mismatch in the second position in the P-site Deposited 2014-10-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 48 PDB declaration: 54-meric	Chain 52 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 673 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.20 Å R-free 0.238
4WZD Complex of 70S ribosome with cognate tRNA-Tyr in the P-site Deposited 2014-11-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 55-meric	Chain 5E 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 699 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.10 Å R-free 0.193
4WZD Complex of 70S ribosome with cognate tRNA-Tyr in the P-site Deposited 2014-11-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 49 PDB declaration: 55-meric	Chain 52 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 646 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.10 Å R-free 0.193
6C5L Conformation of methylated GGQ in the Peptidyl Transferase Center during translation termination (T. thermophilus) Deposited 2018-01-16	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 59-meric	Chain AF 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 218 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；292 K；5 mM HEPES, pH 7.5, 10 mM magnesium acetate, 50 mM potassium chloride, 10 mM ammonium chloride, 6 mM BME	Resolution 3.20 Å R-free 0.247
6C5L Conformation of methylated GGQ in the Peptidyl Transferase Center during translation termination (T. thermophilus) Deposited 2018-01-16	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 53 PDB declaration: 59-meric	Chain CF 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 256 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；292 K；5 mM HEPES, pH 7.5, 10 mM magnesium acetate, 50 mM potassium chloride, 10 mM ammonium chloride, 6 mM BME	Resolution 3.20 Å R-free 0.247
6CFJ Crystal structure of the Thermus thermophilus 70S ribosome in complex with histidyl-CAM and bound to mRNA and A-, P-, and E-site tRNAs at 2.8A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 56-meric	Chain 1f 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 1492 K POTASSIUM ION × 2 EZG N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-histidinamide × 1 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.80 Å R-free 0.269
6CFJ Crystal structure of the Thermus thermophilus 70S ribosome in complex with histidyl-CAM and bound to mRNA and A-, P-, and E-site tRNAs at 2.8A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 49 PDB declaration: 56-meric	Chain 2f 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 1113 K POTASSIUM ION × 2 EZG N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-histidinamide × 1 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.80 Å R-free 0.269
6CFK Crystal structure of the Thermus thermophilus 70S ribosome in complex with D-histidyl-CAM and bound to protein Y (YfiA) at 2.7A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 1f 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 1422 K POTASSIUM ION × 1 EZP N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-D-histidinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 4 ARG ARGININE × 2 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.70 Å R-free 0.253
6CFK Crystal structure of the Thermus thermophilus 70S ribosome in complex with D-histidyl-CAM and bound to protein Y (YfiA) at 2.7A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 2f 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 940 K POTASSIUM ION × 1 EZP N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-D-histidinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 3 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.70 Å R-free 0.253
6CFL Crystal structure of the Thermus thermophilus 70S ribosome in complex with lysyl-CAM and bound to protein Y (YfiA) at 2.6A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 1f 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 1474 K POTASSIUM ION × 1 EZM N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-lysinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 4 ARG ARGININE × 2 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.60 Å R-free 0.252
6CFL Crystal structure of the Thermus thermophilus 70S ribosome in complex with lysyl-CAM and bound to protein Y (YfiA) at 2.6A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 2f 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 955 K POTASSIUM ION × 1 EZM N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-lysinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 3 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.60 Å R-free 0.252

51 other PDB entries and 64 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RS6_THETH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–101； UniProt 1–101

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1qjh
Deposition date deposition_date	1999-06-24
Structure title title	Protein Aggregation and Alzheimer's Disease: Crystallographic Analysis of the Phenomenon. Engineered version of the ribosomal protein S6 used as a stable scaffold to study oligomerization.
Keywords keywords	RIBOSOMAL PROTEIN, ALZHEIMER DISEASE, RIBOSOMAL PROTEIN S6, OLIGOMERIZATION; RIBOSOMAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.63 Å
Radius of gyration Rg (electron density) rg_electron	13.33 Å
Forward intensity I(0) i0	2441650.00
Molecular weight molecular_weight	10954.0 kDa
Excluded volume excluded_volume	13825 Å³
Envelope volume envelope_volume	15735 Å³
Hydration-shell volume shell_volume	10390 Å³
Envelope diameter envelope_diameter	44.4 Å
Shell Rg shell_rg	18.53 Å
Envelope Rg envelope_rg	13.65 Å
Shape Rg shape_rg	13.31 Å
Total Rg total_rg	14.58 Å
Total atoms total_atoms	769
Residues n_residues	93
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	46.1 Å
Rg (real space) rg_real	14.56 Å
Rg uncertainty (real space) rg_real_error	0.22 Å
I(0) (real space) i0_real	2.4420e+06
I(0) uncertainty (real space) i0_real_error	2.6950e+04
Rg (reciprocal space) rg_reciprocal	14.57 Å
I(0) (reciprocal space) i0_reciprocal	2442000.0000
Solution quality estimate total_estimate	0.9005
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	16.9 Å
Skewness Skewness skewness	0.181
Kurtosis Kurtosis kurtosis	-0.452
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	417000.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.905; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.989

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	30S ribosomal protein S6
Molecular weight formula_weight	11830.7 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	814

MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLMVLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA

来源 Source

来源生物 organism	Thermus thermophilus
NCBI Class编号 ncbi_taxonomy_id	274
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	45

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1qjha_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.14 — Ribosomal protein S6
Family Family family	d.58.14.1 — Ribosomal protein S6

CATH v4.4 (1 domains)

Domain ID domain_id	1qjhA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	60 — Ribosomal protein S6/Translation elongation factor EF1B

▶

8. Citations (2)

▶

Unit-cell length a length_a	49.701 Å
Unit-cell length b length_b	49.701 Å
Unit-cell length c length_c	73.255 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 42 21 2
Space-group number int_tables_number	94
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	35.000 Å
R factor r_factor	0.2050
R_work r_work	0.2050
R_free r_free	0.2750

fit	/app/data/saxs_computation/qj/1qjh/1qjh.fit
pddf	/app/data/pr_computation/qj/1qjh/1qjh.pr.out
profile	/app/data/saxs_computation/qj/1qjh/1qjh.dat