1rkc

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)

Method: X-RAY DIFFRACTION D_max: 100.8 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vinculin

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–258	Fragment：vinculin head (residues 1-258)	Talin × 1 （P54939）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4；293 K；2% MPD; 100 mM citric acid (pH 4); 100 mM CdCl2, pH 4.0, temperature 293K	Resolution 2.70 Å R-free 0.335

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1RKC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1RKE Human vinculin head (1-258) in complex with human vinculin tail (879-1066) Deposited 2003-11-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–258（258 aa） Fragment：vinculin head (residues 1-258) Chain B 882–1066（185 aa） Fragment：vinculin tail (residues 879-1066)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；293 K；15% PEG 3350; 50 mM NaCl; 100 mM Tris (pH 8); 10 mM DTT, pH 8.0, temperature 293K	Resolution 2.35 Å R-free 0.278
1SYQ Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636 Deposited 2004-04-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–258（258 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.42 Å R-free 0.236
1SYQ Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636 Deposited 2004-04-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–258（258 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.42 Å R-free 0.236
1SYQ Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin binding site 1, residues 607-636 Deposited 2004-04-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–258（258 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.42 Å R-free 0.236
1TR2 Crystal structure of human full-length vinculin (residues 1-1066) Deposited 2004-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 0–1065（1066 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å R-free 0.300
1TR2 Crystal structure of human full-length vinculin (residues 1-1066) Deposited 2004-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 0–1065（1066 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å R-free 0.300
2GWW Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site (residues 602-633) Deposited 2006-05-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.72 Å R-free 0.291
2GWW Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site (residues 602-633) Deposited 2006-05-07	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.72 Å R-free 0.291
2GWW Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site (residues 602-633) Deposited 2006-05-07	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.72 Å R-free 0.291
2HSQ Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site 2 (residues 565-587) Deposited 2006-07-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.97 Å R-free 0.316
2HSQ Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site 2 (residues 565-587) Deposited 2006-07-22	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.97 Å R-free 0.316
2HSQ Human vinculin (head domain, Vh1, residues 1-258) in complex with Shigella's IpaA vinculin binding site 2 (residues 565-587) Deposited 2006-07-22	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.97 Å R-free 0.316
2IBF Human vinculin's head domain (Vh1, residues 1-258) in complex with two vinculin binding sites of Shigella flexneri's IpaA (residues 565-587) Deposited 2006-09-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 0–257（258 aa） Fragment：Head domain (Vh1): Residues 1-258	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.20 Å R-free 0.270
3JBK Cryo-EM reconstruction of the metavinculin-actin interface Deposited 2015-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain M 858–1129（272 aa） Fragment：tail domain (UNP residues 858-1129)	Not recorded	MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer 50 mM KCl, 1 mM MgCl2, 1 mM EGTA, 10 mM imidazole；pH 7；50 mM KCl, 1 mM MgCl2, 1 mM EGTA, 10 mM imidazole cryo-EM vitrification conditions 3 microliters of 0.3 micromolar actin was applied to the grid and incubated for 60 seconds at 25 degrees C. 3 microliters of 10 micromolar MVt was then applied and incubated for 60 seconds. 3 microliters of solution was removed, then an additional 3 microliters of MVt applied. After 60 seconds, 3 microliters of solution was removed, then the grid was blotted for 2 seconds before plunging.；Cryogen ETHANE；3 microliters of 0.3 micromolar actin was applied to the grid and incubated for 60 seconds at 25 degrees C. 3 microliters of 10 micromolar MVt was then applied and incubated for 60 seconds. 3 microliters of solution was removed, then an additional 3 microliters of MVt applied. After 60 seconds, 3 microliters of solution was removed, then the grid was blotted for 2 seconds before plunging into liquid ethane (LEICA EM GP).	Resolution 8.20 Å
3MYI Human metavinculin tail domain Deposited 2010-05-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 959–1130（172 aa） Fragment：UNP residues 959-1134	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.247
3RF3 Shigella IpaA-VBS3 in complex with human vinculin Deposited 2011-04-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–258（258 aa） Fragment：unp residues 1-258	Not recorded	CAC CACODYLATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；0.1 M sodium citrate, 20% PEG 3350, 0.1 M cacodylate, pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 1.61 Å R-free 0.195
3RF3 Shigella IpaA-VBS3 in complex with human vinculin Deposited 2011-04-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–258（258 aa） Fragment：unp residues 1-258	Not recorded	CAC CACODYLATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；0.1 M sodium citrate, 20% PEG 3350, 0.1 M cacodylate, pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 1.61 Å R-free 0.195
3RF3 Shigella IpaA-VBS3 in complex with human vinculin Deposited 2011-04-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–258（258 aa） Fragment：unp residues 1-258 Chain B 1–258（258 aa） Fragment：unp residues 1-258	Not recorded	CAC CACODYLATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；0.1 M sodium citrate, 20% PEG 3350, 0.1 M cacodylate, pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 1.61 Å R-free 0.195
3S90 Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33; residues 1512-1546) Deposited 2011-05-31	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–252（252 aa） Fragment：unp residues 1-252	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.3；277 K；0.1 M citrate 5.3, 15% (w/v) PEG 10K, 1.5% (v/v) dioxane, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.97 Å R-free 0.210
3S90 Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33; residues 1512-1546) Deposited 2011-05-31	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–252（252 aa） Fragment：unp residues 1-252	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.3；277 K；0.1 M citrate 5.3, 15% (w/v) PEG 10K, 1.5% (v/v) dioxane, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.97 Å R-free 0.210
3TJ5 human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-VBS-N; residues 412-434) from Rickettsia rickettsii Deposited 2011-08-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–255（255 aa） Fragment：unp residues 1-255	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；298 K；0.1 M MES monohydrate pH 6.5, 14% PEG 20,000, 20 mM Tris-HCl pH 8, 150 mM NaCl, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.99 Å R-free 0.218
3TJ6 human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-VBS-C; residues 812-835) from Rickettsia rickettsii Deposited 2011-08-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；298 K；2% (v/v) tacsimate (pH 5), 100 mM sodium citrate tribasic dihydrate (pH 5.6), 16% (w/v) polyethylene glycol (3,350), 20 mM Tris-HCl (pH 9), 150 mM NaCl , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.76 Å R-free 0.235
3TJ6 human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-VBS-C; residues 812-835) from Rickettsia rickettsii Deposited 2011-08-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–257（257 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；298 K；2% (v/v) tacsimate (pH 5), 100 mM sodium citrate tribasic dihydrate (pH 5.6), 16% (w/v) polyethylene glycol (3,350), 20 mM Tris-HCl (pH 9), 150 mM NaCl , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.76 Å R-free 0.235
3VF0 Raver1 in complex with metavinculin L954 deletion mutant Deposited 2012-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 856–1134（279 aa）	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 GOL GLYCEROL × 13	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.54 Å R-free 0.205
4DJ9 Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin binding site 50 (VBS50, residues 2078-2099) Deposited 2012-02-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–258（258 aa） Fragment：unp residues 1-258	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；The human vinculin Vh1 domain (residues 1 - 258) was generated as described.9 Crystallization screens of Vh1 protein and VBS50 mixed in 1:5 molar ratio were performed at two temperatures. Co-crystals were obtained from Hampton crystal screen I with a reservoir of 0.1 M Hepes pH 7.5, 10% w/v polyethylene glycol 6,000, and 5% 2-Methyl-2,4-pentanediol. Crystals were transferred directly from the initial 96-well screening plate into Paratone-N oil and flash-frozen in liquid nitrogen. , VAPOR DIFFUSION	Resolution 2.25 Å R-free 0.247
4EHP Crystal Structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382) Deposited 2012-04-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–252（252 aa） Fragment：unp residues 1-252	Not recorded	ACT ACETATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；PEG 3350, sodium acetate, VAPOR DIFFUSION, temperature 295K	Resolution 2.66 Å R-free 0.229
4LN2 The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin Deposited 2013-07-11	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 857–867（11 aa） Fragment：UNP residues 857-867	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；EVAPORATION	Resolution 1.00 Å R-free 0.152
4LNP The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin Deposited 2013-07-11	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 870–879（10 aa） Fragment：proline rich peptide, UNP residues 870-879	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 8；293 K；pH 8.0, EVAPORATION, temperature 293K	Resolution 1.41 Å R-free 0.194
4PR9 Human Vinculin (residues 891-1066) in complex with PIP Deposited 2014-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 891–1066（176 aa） Fragment：C-terminal domain (UNP residues 891-1066 of isoform 1) Chain B 891–1066（176 aa） Fragment：C-terminal domain (UNP residues 891-1066 of isoform 1)	Mutation：R1060A Mutation：R1060A	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；12% PEG3350, 2% tryptone, 0.05 M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 3.20 Å R-free 0.250
4PR9 Human Vinculin (residues 891-1066) in complex with PIP Deposited 2014-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 891–1066（176 aa） Fragment：C-terminal domain (UNP residues 891-1066 of isoform 1) Chain D 891–1066（176 aa） Fragment：C-terminal domain (UNP residues 891-1066 of isoform 1)	Mutation：R1060A Mutation：R1060A	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；12% PEG3350, 2% tryptone, 0.05 M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 3.20 Å R-free 0.250
4PR9 Human Vinculin (residues 891-1066) in complex with PIP Deposited 2014-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 891–1066（176 aa） Fragment：C-terminal domain (UNP residues 891-1066 of isoform 1) Chain F 891–1066（176 aa） Fragment：C-terminal domain (UNP residues 891-1066 of isoform 1)	Mutation：R1060A Mutation：R1060A	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；12% PEG3350, 2% tryptone, 0.05 M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 3.20 Å R-free 0.250
5L0C Human metavinculin (residues 959-1134) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 959–1134（176 aa） Fragment：UNP Residues 959-1130 Chain C 959–1134（176 aa） Fragment：UNP Residues 959-1130	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；20 mM citric acid, 80 mM Bis-Tris propane (pH 3.4), and 16% (w/v) PEG 3350	Resolution 3.10 Å R-free 0.261
5L0C Human metavinculin (residues 959-1134) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 959–1134（176 aa） Fragment：UNP Residues 959-1130 Chain D 959–1134（176 aa） Fragment：UNP Residues 959-1130	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 3 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；20 mM citric acid, 80 mM Bis-Tris propane (pH 3.4), and 16% (w/v) PEG 3350	Resolution 3.10 Å R-free 0.261
5L0D Human Metavinculin(residues 959-1130) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 959–1130（172 aa） Fragment：UNP Residues 959-1130 Chain B 959–1130（172 aa） Fragment：UNP Residues 959-1130	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 3.4；294 K；20 mM citric acid, 80-100 mM Bis-Tris propane (pH 3.4), and 12-16% (w/v) PEG 3350	Resolution 2.75 Å R-free 0.259
5L0D Human Metavinculin(residues 959-1130) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 959–1130（172 aa） Fragment：UNP Residues 959-1130 Chain D 959–1130（172 aa） Fragment：UNP Residues 959-1130	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 3.4；294 K；20 mM citric acid, 80-100 mM Bis-Tris propane (pH 3.4), and 12-16% (w/v) PEG 3350	Resolution 2.75 Å R-free 0.259
5L0F Human metavinculin quadruple mutant (residues 959-1134) Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 959–1134（176 aa） Fragment：UNP Residues 959-1134	Mutation：R975Q, K979Q, R1107Q, R1128Q	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；294 K；20 mM citric acid, 80 mM Bis-Tris propane (pH 8.8), and 14 to 16% (w/v) PEG 3350	Resolution 2.76 Å R-free 0.247
5L0F Human metavinculin quadruple mutant (residues 959-1134) Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 959–1134（176 aa） Fragment：UNP Residues 959-1134	Mutation：R975Q, K979Q, R1107Q, R1128Q	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；294 K；20 mM citric acid, 80 mM Bis-Tris propane (pH 8.8), and 14 to 16% (w/v) PEG 3350	Resolution 2.76 Å R-free 0.247
5L0G Human metavinculin MVt Q971R, R975D, T978R mutant (residues 959-1134) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 959–1134（176 aa） Fragment：UNP Residues 959-1134 Chain B 959–1134（176 aa） Fragment：UNP Residues 959-1134	Mutation：Q971R, R975D, T978R Mutation：Q971R, R975D, T978R	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；12% PEG 3350, 2% tryptone, and 0.05 M HEPES	Resolution 3.40 Å R-free 0.221
5L0G Human metavinculin MVt Q971R, R975D, T978R mutant (residues 959-1134) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 959–1134（176 aa） Fragment：UNP Residues 959-1134 Chain D 959–1134（176 aa） Fragment：UNP Residues 959-1134	Mutation：Q971R, R975D, T978R Mutation：Q971R, R975D, T978R	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；12% PEG 3350, 2% tryptone, and 0.05 M HEPES	Resolution 3.40 Å R-free 0.221
5L0H Human metavinculin MVt cardiomyopathy-associated mutant R975W (residues 959-1134) in complex with PIP2 Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 959–1134（176 aa） Fragment：UNP Residues 959-1134	Mutation：R975W	PEG DI(HYDROXYETHYL)ETHER × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；0.2 M LiSO4, 0.1 M HEPES (pH 7.5), and 22% PEG 3350	Resolution 2.90 Å R-free 0.278
5L0I Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134) Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 959–1134（176 aa） Fragment：UNP Residues 959-1134	Mutation：R975W	GOL GLYCEROL × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；294 K；0.1 M Na-citrate tribasic dihydrate, 2% Tacsimate (pH 5), and 16% PEG 3350	Resolution 2.45 Å R-free 0.238
5L0J Human vinculin R903Q, D907R, R910T mutant(residues 891-1066) Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 891–1066（176 aa） Chain B 891–1066（176 aa）	Mutation：R903Q, D907R, R910T Mutation：R903Q, D907R, R910T	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；0.1 M HEPES sodium (pH 7.5), and 1.5 M Lithium sulfate monohydrate	Resolution 4.00 Å R-free 0.298
6FUY Crystal structure of human full-length vinculin-T12-A974K (residues 1-1066) Deposited 2018-02-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–1066（1066 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；PEG 4000, calcium acetate, Tris-HOAc, 15% ethylene glycol	Resolution 3.00 Å R-free 0.305
6UPW Metavinculin ABD-F-actin complex Deposited 2019-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain L 1–1134（1134 aa） Chain M 1–1134（1134 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7KTT Cryogenic electron microscopy model of full-length human metavinculin Deposited 2020-11-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–1134（1134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, pH 8.0, 150 mM NaCl, 0.2 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.17 Å
7KTU Cryogenic electron microscopy model of full-length human metavinculin H1'-parallel conformation 1 Deposited 2020-11-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–1134（1134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, pH 8.0, 150 mM NaCl, 0.2 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.15 Å
7KTV Cryogenic electron microscopy model of full-length human metavinculin H1' kinked conformation Deposited 2020-11-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–1134（1134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, pH 8.0, 150 mM NaCl, 0.2 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
7KTW Cryogenic electron microscopy model of full-length human metavinculin H1'-parallel conformation 2 Deposited 2020-11-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–1134（1134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris, pH 8.0, 150 mM NaCl, 0.2 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.27 Å
9QWO Vinculin tail bound to paxillin LD2 Deposited 2025-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 891–1066（176 aa） Chain B 891–1066（176 aa） Chain C 891–1066（176 aa） Chain D 891–1066（176 aa）	Not recorded	SO4 SULFATE ION × 8 ACT ACETATE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；1.26 M (NH4)2SO4, 0.2 M NaCl, 0.1 M Na Acetate pH4.5	Resolution 2.54 Å R-free 0.259

32 other PDB entries and 49 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VINC_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–262； UniProt 1–258

Talin

Gallus gallus

UniProt P54939

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1944–1969	Fragment：binding site 3 (residues 1944-1969)	Vinculin × 1 （P18206）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4；293 K；2% MPD; 100 mM citric acid (pH 4); 100 mM CdCl2, pH 4.0, temperature 293K	Resolution 2.70 Å R-free 0.335

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1RKC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1MIX Crystal structure of a FERM domain of Talin Deposited 2002-08-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 196–400（205 aa） Fragment：Second and third subdomains of FERM domain (Residues 196-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 1.75 Å R-free 0.239
1MIZ Crystal structure of an integrin beta3-talin chimera Deposited 2002-08-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–400（201 aa） Fragment：Residues 200-400	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；pH 7.0, VAPOR DIFFUSION, HANGING DROP	Resolution 1.90 Å R-free 0.246
1MK7 CRYSTAL STRUCTURE OF AN INTEGRIN BETA3-TALIN CHIMERA Deposited 2002-08-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 209–400（192 aa） Fragment：F2 AND F3 SUBDOMAINS OF FERM DOMAIN (Residues 209-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M TRIS-HCL, 18% (W/V) PEG-MME 2000, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
1MK7 CRYSTAL STRUCTURE OF AN INTEGRIN BETA3-TALIN CHIMERA Deposited 2002-08-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 209–400（192 aa） Fragment：F2 AND F3 SUBDOMAINS OF FERM DOMAIN (Residues 209-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；0.1 M TRIS-HCL, 18% (W/V) PEG-MME 2000, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
1MK9 CRYSTAL STRUCTURE OF AN INTEGRIN BETA3-TALIN CHIMERA Deposited 2002-08-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 209–400（192 aa） Fragment：F2 AND F3 SUBDOMAINS OF FERM DOMAIN (Residues 209-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；277 K；PEG 8000, MAGNESIUM CHLORIDE, TRIS-HCL, pH 8.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1MK9 CRYSTAL STRUCTURE OF AN INTEGRIN BETA3-TALIN CHIMERA Deposited 2002-08-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 209–400（192 aa） Fragment：F2 AND F3 SUBDOMAINS OF FERM DOMAIN (Residues 209-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；277 K；PEG 8000, MAGNESIUM CHLORIDE, TRIS-HCL, pH 8.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1MK9 CRYSTAL STRUCTURE OF AN INTEGRIN BETA3-TALIN CHIMERA Deposited 2002-08-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 209–400（192 aa） Fragment：F2 AND F3 SUBDOMAINS OF FERM DOMAIN (Residues 209-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；277 K；PEG 8000, MAGNESIUM CHLORIDE, TRIS-HCL, pH 8.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1MK9 CRYSTAL STRUCTURE OF AN INTEGRIN BETA3-TALIN CHIMERA Deposited 2002-08-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 209–400（192 aa） Fragment：F2 AND F3 SUBDOMAINS OF FERM DOMAIN (Residues 209-400)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；277 K；PEG 8000, MAGNESIUM CHLORIDE, TRIS-HCL, pH 8.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1ZVZ Vinculin Head (0-258) in Complex with the Talin Rod Residue 820-844 Deposited 2005-06-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 820–844（25 aa） Fragment：Residues 820-844	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.80 Å R-free 0.276
2H7D Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP kinase peptide Deposited 2006-06-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 309–405（97 aa） Fragment：F3 domain	Mutation：C336S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.1；298 K；Ionic strength (raw mmCIF value) 100mM NaCl；Pressure ambient NMR sample composition 1.2mM Talin F3 U-15N; 1.4mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 1.5mM Talin F3; 1.5mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 99.96% D2O \| 99.96% D2O NMR sample composition 1.9mM Talin F3 U-15N,2H; 1.5mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 1.9mM Talin F3 U-15N,2H; 1.5mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 99.96% D2O \| 99.96% D2O NMR sample composition 0.9mM Talin F3 U-15N,13C; 1.1mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2H7E Solution structure of the talin F3 domain in complex with a chimeric beta3 integrin-PIP kinase peptide- minimized average structure Deposited 2006-06-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 309–405（97 aa） Fragment：F3 domain	Mutation：C336S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.1；298 K；Ionic strength (raw mmCIF value) 100mM NaCl；Pressure ambient NMR sample composition 1.2mM Talin F3 U-15N; 1.4mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 1.5mM Talin F3; 1.5mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 99.96% D2O \| 99.96% D2O NMR sample composition 1.9mM Talin F3 U-15N,2H; 1.5mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 1.9mM Talin F3 U-15N,2H; 1.5mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 99.96% D2O \| 99.96% D2O NMR sample composition 0.9mM Talin F3 U-15N,13C; 1.1mM chimeric peptide; 50mM phosphate buffer pH 6.1, 100mM NaCl; 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2HRJ NMR solution structure of the F2 subdomain of talin Deposited 2006-07-20	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 189–309（121 aa） Fragment：F2 subdomain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Pressure ambient NMR measurement conditions pH 6.5；310 K；Pressure ambient	Resolution not provided
2K00 Solution structure of the talin F3 in complex with layilin cytodomain Deposited 2008-01-23	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 309–400（92 aa） Fragment：residues 309-400	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.1；298 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 1 mM [U-13C; U-15N] protein, 3.5 mM peptide, 100 mM sodium chloride, 50 mM sodium phosphate, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
8S4Y Crystal structure of an APP-talin (F2F3) chimera Deposited 2024-02-22	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 209–400（192 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.1 M Tris pH 8.5, 10% v/v ethanol	Resolution 2.70 Å R-free 0.267

10 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TLN1_CHICK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–26； UniProt 1944–1969

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1rkc
Deposition date deposition_date	2003-11-21
Structure title title	Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Keywords keywords	cytoskeleton; actin-binding; x-ray crystallography, cell adhesion, structural protein; cell adhesion, structural protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.22 Å
Radius of gyration Rg (electron density) rg_electron	26.35 Å
Forward intensity I(0) i0	17090900.00
Molecular weight molecular_weight	31763.0 kDa
Excluded volume excluded_volume	40023 Å³
Envelope volume envelope_volume	49620 Å³
Hydration-shell volume shell_volume	18473 Å³
Envelope diameter envelope_diameter	106.3 Å
Shell Rg shell_rg	29.12 Å
Envelope Rg envelope_rg	26.86 Å
Shape Rg shape_rg	26.37 Å
Total Rg total_rg	26.65 Å
Total atoms total_atoms	2223
Residues n_residues	284
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	100.8 Å
Rg (real space) rg_real	26.74 Å
Rg uncertainty (real space) rg_real_error	1.11 Å
I(0) (real space) i0_real	1.7090e+07
I(0) uncertainty (real space) i0_real_error	2.9730e+05
Rg (reciprocal space) rg_reciprocal	26.58 Å
I(0) (reciprocal space) i0_reciprocal	17090000.0000
Solution quality estimate total_estimate	0.5330
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	21.5 Å
Skewness Skewness skewness	0.765
Kurtosis Kurtosis kurtosis	0.139
Angular range angular_range	— – 0.3050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4598000.0000
Real-space data points n_real_points	62
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.395; Stabil: 1.000; Sysdev: 0.221; Positv: 1.000; Valcen: 0.186; Smooth: 0.891

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Vinculin
Molecular weight formula_weight	29490.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2223

HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Talin
Molecular weight formula_weight	2905.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

YTKKELIESARKVSEKVSHVLAALQA

来源 Source

来源生物 organism	Gallus gallus
通用名 common_name	chicken
NCBI Class编号 ncbi_taxonomy_id	9031
宿主生物 host_organism	Escherichia coli

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1rkca1
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.9 — alpha-catenin/vinculin-like
Family Family family	a.24.9.1 — alpha-catenin/vinculin

Domain ID domain_id	d1rkca2
Class class	a — All alpha proteins
Fold Fold fold	a.24 — Four-helical up-and-down bundle
Superfamily Superfamily superfamily	a.24.9 — alpha-catenin/vinculin-like
Family Family family	a.24.9.1 — alpha-catenin/vinculin

CATH v4.4 (2 domains)

Domain ID domain_id	1rkcA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	230 — Alpha-catenin/vinculin-like

Domain ID domain_id	1rkcA02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	230 — Alpha-catenin/vinculin-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	155.680 Å
Unit-cell length b length_b	155.680 Å
Unit-cell length c length_c	155.680 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 41 3 2
Space-group number int_tables_number	214
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	—
R_work r_work	0.2440
R_free r_free	0.3350

fit	/app/data/saxs_computation/rk/1rkc/1rkc.fit
pddf	/app/data/pr_computation/rk/1rkc/1rkc.pr.out
profile	/app/data/saxs_computation/rk/1rkc/1rkc.dat

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vinculin

State in the Current Structure

Other States of the Same Protein in the Database

Talin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)