1xi4

Clathrin D6 Coat

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Clathrin heavy chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Clathrin light chain A × 108 （P04973）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 18	Clathrin light chain A × 9 （P04973）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 18	Clathrin light chain A × 9 （P04973）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CLH_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1630； UniProt 1–1630 Author chain B； PDBConstruct 1–1630； UniProt 1–1630 Author chain C； PDBConstruct 1–1630； UniProt 1–1630 Author chain D； PDBConstruct 1–1630； UniProt 1–1630 Author chain E； PDBConstruct 1–1630； UniProt 1–1630 Author chain F； PDBConstruct 1–1630； UniProt 1–1630 Author chain G； PDBConstruct 1–1630； UniProt 1–1630 Author chain H； PDBConstruct 1–1630； UniProt 1–1630 Author chain I； PDBConstruct 1–1630； UniProt 1–1630

Clathrin light chain A

OrganismNot specified

UniProt P04973

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 216	Clathrin heavy chain × 108 （P49951）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 18	Clathrin heavy chain × 9 （P49951）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 18	Clathrin heavy chain × 9 （P49951）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CLCA_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–70； UniProt 95–164 Author chain K； PDBConstruct 1–70； UniProt 95–164 Author chain L； PDBConstruct 1–70； UniProt 95–164 Author chain M； PDBConstruct 1–70； UniProt 95–164 Author chain N； PDBConstruct 1–70； UniProt 95–164 Author chain O； PDBConstruct 1–70； UniProt 95–164 Author chain P； PDBConstruct 1–70； UniProt 95–164 Author chain Q； PDBConstruct 1–70； UniProt 95–164 Author chain R； PDBConstruct 1–70； UniProt 95–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1xi4
Deposition date deposition_date	2004-09-21
Structure title title	Clathrin D6 Coat
Keywords keywords	clathrin, alpha-zig-zag, beta-propeller, ENDOCYTOSIS-EXOCYTOSIS COMPLEX; ENDOCYTOSIS/EXOCYTOSIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1xi4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1xi4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1xi4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	319.80 Å
Total Rg	319.80 Å
Atom count	0
Residues	0
Excluded volume	25883000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1xi4__assembly_1__model_1`	216-MERIC （216）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1xi4__assembly_2__model_1`	octadecameric （18）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`1xi4__assembly_3__model_1`	octadecameric （18）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Clathrin heavy chain
Molecular weight formula_weight	187145.1 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I
Atom count atom_count	15300

MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQ

Entity 2 Entity 2 polymer

Description description	Clathrin light chain A
Molecular weight formula_weight	8539.3 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,L,M,N,O,P,Q,R

VDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELDEWYARQDEQLQKTKANNRVADEAFY

▼

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (18 domains)

Domain ID domain_id	d1xi4a_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4b_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4c_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4d_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4e_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4f_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4g_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4h_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4i_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4j_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4k_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4l_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4m_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4n_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4o_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4p_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4q_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

Domain ID domain_id	d1xi4r_
Class class	i — Low resolution protein structures
Fold Fold fold	i.23 — clathrin assemblies
Superfamily Superfamily superfamily	i.23.1 — clathrin assemblies
Family Family family	i.23.1.1 — clathrin assemblies

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.90 Å
Resolution测定Method resolution_method	FOURIER SPACE RECONSTRUCTION
颗粒数 num_particles	1450

Clathrin D6 Coat

1. Protein Identity and Related Structures Protein Identity & Related Structures

Clathrin heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Clathrin light chain A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xi4__assembly_1__model_1

1xi4__assembly_1__model_1 | I(q)

1xi4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (18 domains)

7. Citations (2)

Clathrin D6 Coat

1. Protein Identity and Related Structures Protein Identity & Related Structures

Clathrin heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Clathrin light chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xi4__assembly_1__model_1

1xi4__assembly_1__model_1 | I(q)

1xi4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (18 domains)

7. Citations (2)