2uzq

Protein Phosphatase, New Crystal Form

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

M-PHASE INDUCER PHOSPHATASE 2

HOMO SAPIENS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 2 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MPIP2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 14–203； UniProt 377–566 Author chain B； PDBConstruct 14–203； UniProt 377–566 Author chain C； PDBConstruct 14–203； UniProt 377–566 Author chain D； PDBConstruct 14–203； UniProt 377–566 Author chain E； PDBConstruct 14–203； UniProt 377–566 Author chain F； PDBConstruct 14–203； UniProt 377–566

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2uzq
Deposition date deposition_date	2007-05-01
Structure title title	Protein Phosphatase, New Crystal Form
Keywords keywords	HYDROLASE, CELL DIVISION, PHOSPHORYLATION, DUAL SPECIFICITY, MITOSIS, CELL CYCLE, PHOSPHATASE, PROTEIN PHOSPHATASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2uzq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2uzq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2uzq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.49 Å
Rg (electron density)	24.13 Å
Total Rg	24.97 Å
Atom count	2834
Residues	344
Excluded volume	50591 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2uzq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2uzq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2uzq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	M-PHASE INDUCER PHOSPHATASE 2
Molecular weight formula_weight	23450.8 kDa
EC 编号 ec_number	3.1.3.48
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	8698

GSPGISGGGGGILELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	196

▼

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d2uzqa2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.46 — Rhodanese/Cell cycle control phosphatase
Superfamily Superfamily superfamily	c.46.1 — Rhodanese/Cell cycle control phosphatase
Family Family family	c.46.1.1 — Cell cycle control phosphatase, catalytic domain

Domain ID domain_id	d2uzqa3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2uzqb2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.46 — Rhodanese/Cell cycle control phosphatase
Superfamily Superfamily superfamily	c.46.1 — Rhodanese/Cell cycle control phosphatase
Family Family family	c.46.1.1 — Cell cycle control phosphatase, catalytic domain

Domain ID domain_id	d2uzqb3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2uzqc2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.46 — Rhodanese/Cell cycle control phosphatase
Superfamily Superfamily superfamily	c.46.1 — Rhodanese/Cell cycle control phosphatase
Family Family family	c.46.1.1 — Cell cycle control phosphatase, catalytic domain

Domain ID domain_id	d2uzqc3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2uzqd2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.46 — Rhodanese/Cell cycle control phosphatase
Superfamily Superfamily superfamily	c.46.1 — Rhodanese/Cell cycle control phosphatase
Family Family family	c.46.1.1 — Cell cycle control phosphatase, catalytic domain

Domain ID domain_id	d2uzqd3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2uzqe2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.46 — Rhodanese/Cell cycle control phosphatase
Superfamily Superfamily superfamily	c.46.1 — Rhodanese/Cell cycle control phosphatase
Family Family family	c.46.1.1 — Cell cycle control phosphatase, catalytic domain

Domain ID domain_id	d2uzqe3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2uzqf2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.46 — Rhodanese/Cell cycle control phosphatase
Superfamily Superfamily superfamily	c.46.1 — Rhodanese/Cell cycle control phosphatase
Family Family family	c.46.1.1 — Cell cycle control phosphatase, catalytic domain

Domain ID domain_id	d2uzqf3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (6 domains)

Domain ID domain_id	2uzqA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	2uzqB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	2uzqC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	2uzqD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	2uzqE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	2uzqF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

▶

Unit-cell length a length_a	123.925 Å
Unit-cell length b length_b	123.925 Å
Unit-cell length c length_c	174.035 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	P 61
Space-group number int_tables_number	169
Crystal system crystal_system	—

Resolution resolution	2.380 Å
Low-resolution limit resolution_low	36.770 Å
R factor r_factor	—
R_work r_work	0.2260
R_free r_free	0.2490

Protein Phosphatase, New Crystal Form

1. Protein Identity and Related Structures Protein Identity & Related Structures

M-PHASE INDUCER PHOSPHATASE 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2uzq__assembly_1__model_1

2uzq__assembly_1__model_1 | I(q)

2uzq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (12 domains)

CATH v4.4 (6 domains)

7. Citations (3)

Protein Phosphatase, New Crystal Form

1. Protein Identity and Related Structures Protein Identity & Related Structures

M-PHASE INDUCER PHOSPHATASE 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2uzq__assembly_1__model_1

2uzq__assembly_1__model_1 | I(q)

2uzq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (12 domains)

CATH v4.4 (6 domains)

7. Citations (3)