3fz2

Crystal structure of the tail terminator protein from phage lambda (gpU-D74A)

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Minor tail protein U

Enterobacteria phage lambda

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	SULFATE ION × 7 water × 6	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 6	SULFATE ION × 6 water × 6	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 12	SULFATE ION × 13 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VMTU_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–134； UniProt 1–131 Author chain B； PDBConstruct 4–134； UniProt 1–131 Author chain C； PDBConstruct 4–134； UniProt 1–131 Author chain D； PDBConstruct 4–134； UniProt 1–131 Author chain E； PDBConstruct 4–134； UniProt 1–131 Author chain F； PDBConstruct 4–134； UniProt 1–131 Author chain G； PDBConstruct 4–134； UniProt 1–131 Author chain H； PDBConstruct 4–134； UniProt 1–131 Author chain I； PDBConstruct 4–134； UniProt 1–131 Author chain J； PDBConstruct 4–134； UniProt 1–131 Author chain K； PDBConstruct 4–134； UniProt 1–131 Author chain L； PDBConstruct 4–134； UniProt 1–131

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3fz2
Deposition date deposition_date	2009-01-23
Structure title title	Crystal structure of the tail terminator protein from phage lambda (gpU-D74A)
Keywords keywords	Mixed Alpha-Beta fold, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3fz2__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3fz2__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3fz2__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.62 Å
Rg (electron density)	30.87 Å
Total Rg	31.65 Å
Atom count	6009
Residues	763
Excluded volume	106300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3fz2__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3fz2__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3fz2__assembly_3__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Minor tail protein U
Molecular weight formula_weight	15131.9 kDa
Mutation mutation	D74A
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	12258

GSHMKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPASELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM

Source Source

Source organism organism	Enterobacteria phage lambda
Common name common_name	Bacteriophage lambda
NCBI taxonomy ID ncbi_taxonomy_id	10710
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	246

▼

6. Fold Classification (SCOP + CATH) 34 domains

SCOP 2.08 (22 domains)

Domain ID domain_id	d3fz2a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2d1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2e1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2e2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2f1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2f2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2g1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2g2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2h1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2h2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2i_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2j1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2j2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2k1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2k2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fz2l1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.323 — Phage tail protein-like
Superfamily Superfamily superfamily	d.323.1 — Phage tail protein-like
Family Family family	d.323.1.1 — Lambda phage gpU-like

Domain ID domain_id	d3fz2l2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (12 domains)

Domain ID domain_id	3fz2A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2E00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2G00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2H00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2I00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2J00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2K00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

Domain ID domain_id	3fz2L00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1700 — Phage minor tail protein U

▶

Unit-cell length a length_a	87.370 Å
Unit-cell length b length_b	125.400 Å
Unit-cell length c length_c	211.610 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	46.840 Å
R factor r_factor	0.2330
R_work r_work	0.2330
R_free r_free	0.2830

Crystal structure of the tail terminator protein from phage lambda (gpU-D74A)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Minor tail protein U

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fz2__assembly_2__model_1

3fz2__assembly_2__model_1 | I(q)

3fz2__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 34 domains

SCOP 2.08 (22 domains)

CATH v4.4 (12 domains)

7. Citations (1)

Crystal structure of the tail terminator protein from phage lambda (gpU-D74A)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Minor tail protein U

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fz2__assembly_2__model_1

3fz2__assembly_2__model_1 | I(q)

3fz2__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 34 domains

SCOP 2.08 (22 domains)

CATH v4.4 (12 domains)

7. Citations (1)