3j0e

Models for the T. thermophilus ribosome recycling factor and the E. coli elongation factor G bound to the E. coli post-termination complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S12

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 6	ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 16S RNA × 1 ribosomal 16S RNA × 1 Ribosome-recycling factor × 1 （Q9WX76） Elongation factor G × 1 （P0A6M8）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_ECOLI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–123； UniProt 2–124

Ribosome-recycling factor

OrganismNot specified

UniProt Q9WX76

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 6	ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 16S RNA × 1 ribosomal 16S RNA × 1 30S ribosomal protein S12 × 1 （P0A7S3） Elongation factor G × 1 （P0A6M8）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRF_THET8
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain G； PDBConstruct 1–185； UniProt 1–185

Elongation factor G

OrganismNot specified

UniProt P0A6M8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 6	ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 16S RNA × 1 ribosomal 16S RNA × 1 30S ribosomal protein S12 × 1 （P0A7S3） Ribosome-recycling factor × 1 （Q9WX76）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFG_ECOLI
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain H； PDBConstruct 1–702； UniProt 2–703

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3j0e
Deposition date deposition_date	2011-06-29
Structure title title	Models for the T. thermophilus ribosome recycling factor and the E. coli elongation factor G bound to the E. coli post-termination complex
Keywords keywords	ribosome, ribosome recycling factor, Elongation Factor G, TRANSLATION; TRANSLATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3j0e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3j0e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3j0e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.90 Å
Rg (electron density)	43.40 Å
Total Rg	43.64 Å
Atom count	10187
Residues	1118
Excluded volume	172650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3j0e__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	6994.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	10187

CGGCCGUAACUAUAACGGUCCU

Entity 2 Entity 2 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	5459.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

GUCGGGUAAGUUCCGAC

Entity 3 Entity 3 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	4228.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C

GACUGGGGCGGUC

Entity 4 Entity 4 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	6117.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	D

GAACGUCGUGAGACAGUUC

Entity 5 Entity 5 polymer

Description description	ribosomal 16S RNA
Molecular weight formula_weight	5787.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E

CGUCACACCAUGGGAGUG

Entity 6 Entity 6 polymer

Description description	ribosomal 16S RNA
Molecular weight formula_weight	6173.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	e

CAUGACUGGGGUGAAGUCG

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	13637.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA

Entity 8 Entity 8 polymer

Description description	Ribosome-recycling factor
Molecular weight formula_weight	21029.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRREALDKLKKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEILG

Entity 9 Entity 9 polymer

Description description	Elongation factor G
Molecular weight formula_weight	77415.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

ARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVNQIKTRLGANPVPLQLAIGAEEHFTGVVDLVKMKAINWNDADQGVTFEYEDIPADMVELANEWHQNLIESAAEASEELMEKYLGGEELTEAEIKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPSPVDVPAINGILDDGKDTPAERHASDDEPFSALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKAARERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCDPDAPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREFNVEANVGKPQVAYRETIRQKVTDVEGKHAKQSGGRGQYGHVVIDMYPLEPGSNPKGYEFINDIKGGVIPGEYIPAVDKGIQEQLKAGPLAGYPVVDMGIRLHFGSYHDVDSSELAFKLAASIAFKEGFKKAKPVLLEPIMKVEVETPEENTGDVIGDLSRRRGMLKGQESEVTGVKIHAEVPLSEMFGYATQLRSLTKGRASYTMEFLKYDEAPSNVAQAVIEARG

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.90 Å
Resolution测定Method resolution_method	3D PROJECTION MATCHING
颗粒数 num_particles	338823

Models for the T. thermophilus ribosome recycling factor and the E. coli elongation factor G bound to the E. coli post-termination complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Ribosome-recycling factor

State in the Current Structure

Other States of the Same Protein in the Database

Elongation factor G

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3j0e__assembly_1__model_1

3j0e__assembly_1__model_1 | I(q)

3j0e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

7. Citations (1)

Models for the T. thermophilus ribosome recycling factor and the E. coli elongation factor G bound to the E. coli post-termination complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome-recycling factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Elongation factor G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3j0e__assembly_1__model_1

3j0e__assembly_1__model_1 | I(q)

3j0e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

7. Citations (1)