3j0d

Models for the T. thermophilus ribosome recycling factor bound to the E. coli post-termination complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L11

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 8	ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 16S RNA × 1 ribosomal 16S RNA × 1 30S ribosomal protein S12 × 1 （P0A7S3） Ribosome-recycling factor × 1 （Q9WX76）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL11_ECOLI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–141； UniProt 2–142

30S ribosomal protein S12

OrganismNot specified

UniProt P0A7S3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 8	ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 50S ribosomal protein L11 × 1 （P0A7J7） ribosomal 16S RNA × 1 ribosomal 16S RNA × 1 Ribosome-recycling factor × 1 （Q9WX76）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_ECOLI
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–123； UniProt 2–124

Ribosome-recycling factor

OrganismNot specified

UniProt Q9WX76

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 8	ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 ribosomal 23S RNA × 1 50S ribosomal protein L11 × 1 （P0A7J7） ribosomal 16S RNA × 1 ribosomal 16S RNA × 1 30S ribosomal protein S12 × 1 （P0A7S3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRF_THET8
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain J； PDBConstruct 1–185； UniProt 1–185

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3j0d
Deposition date deposition_date	2011-06-29
Structure title title	Models for the T. thermophilus ribosome recycling factor bound to the E. coli post-termination complex
Keywords keywords	ribosome, ribosome recycling factor, TRANSLATION; TRANSLATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3j0d__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3j0d__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3j0d__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.11 Å
Rg (electron density)	44.78 Å
Total Rg	45.03 Å
Atom count	7260
Residues	626
Excluded volume	115550 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3j0d__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	16114.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	7260

GGAUGUUGGCUUAGAAGCAGCCAUCAUUUAAAGAAAGCGUAAUAGCUCAC

Entity 2 Entity 2 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	6994.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

CGGCCGUAACUAUAACGGUCCU

Entity 3 Entity 3 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	5459.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C

GUCGGGUAAGUUCCGAC

Entity 4 Entity 4 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	4228.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	D

GACUGGGGCGGUC

Entity 5 Entity 5 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	6117.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E

GAACGUCGUGAGACAGUUC

Entity 6 Entity 6 polymer

Description description	ribosomal 23S RNA
Molecular weight formula_weight	6155.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	F

CCUAGUACGAGAGGACCGG

Entity 7 Entity 7 polymer

Description description	50S ribosomal protein L11
Molecular weight formula_weight	14763.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

Entity 8 Entity 8 polymer

Description description	ribosomal 16S RNA
Molecular weight formula_weight	5787.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	H

CGUCACACCAUGGGAGUG

Entity 9 Entity 9 polymer

Description description	ribosomal 16S RNA
Molecular weight formula_weight	6173.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	h

CAUGACUGGGGUGAAGUCG

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	13637.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPKA

Entity 11 Entity 11 polymer

Description description	Ribosome-recycling factor
Molecular weight formula_weight	21029.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRREALDKLKKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEILG

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	11.10 Å
Resolution测定Method resolution_method	3D PROJECTION MATCHING
颗粒数 num_particles	153927

Models for the T. thermophilus ribosome recycling factor bound to the E. coli post-termination complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome-recycling factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3j0d__assembly_1__model_1

3j0d__assembly_1__model_1 | I(q)

3j0d__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

7. Citations (1)