3kui

Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a

Method: X-RAY DIFFRACTION D_max: 52.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polyadenylate-binding protein 1

Homo sapiens

UniProt P11940

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 544–626	Fragment：C-terminal domain	GSPT1 protein × 1 （Q96GF2） ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.4；295 K；2.1M ammonium sulfate, 0.2M sodium sulfate, 10mM zinc chloride, 0.1M sodium acetate, pH 5.4, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.30 Å R-free 0.255

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3KUI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain B 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain C 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain D 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain E 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain F 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain G 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1CVJ X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX WITH POLYADENYLATE RNA Deposited 1999-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain H 1–190（190 aa） Fragment：RESIDUES 1-190	Not recorded	AMP ADENOSINE MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；296.7 K；AMMONIUM SULFATE, TCEP, TRIS-HCL, POTASSIUM CHLORIDE, GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.7K	Resolution 2.60 Å R-free 0.304
1G9L SOLUTION STRUCTURE OF THE PABC DOMAIN OF HUMAN POLY(A) BINDING PROTEIN Deposited 2000-11-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 498–636（139 aa） Fragment：C-TERMINAL DOMAIN (RESIDUES 498-636)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；303 K；Ionic strength (raw mmCIF value) 0.2；Pressure ambient NMR sample composition 3mM 15N-labeled PABC; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O NMR sample composition 3mM 15N,13C-labeled PABC; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 100% D2O NMR sample composition 3mM unlabeled PABC; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O	Resolution not provided
1JGN Solution structure of the C-terminal PABC domain of human poly(A)-binding protein in complex with the peptide from Paip2 Deposited 2001-06-26	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–636（93 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；303 K；Ionic strength (raw mmCIF value) 0.1M NaCl；Pressure ambient NMR sample composition 3mM 15N-labeled PABC; 4mM unlabeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O NMR sample composition 3mM 15N,13C-labeled PABC; 4mM unlabeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 100% D2O NMR sample composition 2.5mM 15N-labeled peptide; 3mM unlabeled PABC; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O NMR sample composition 2mM 15N,13C-labeled peptide; 3mM unlabeled PABC; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 100% D2O NMR sample composition 3mM unlabeled PABC; 3mM unlabeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O NMR sample composition 3mM unlabeled PABC; 3mM unlabeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 100% D2O	Resolution not provided
1JH4 Solution structure of the C-terminal PABC domain of human poly(A)-binding protein in complex with the peptide from Paip1 Deposited 2001-06-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–636（93 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；303 K；Ionic strength (raw mmCIF value) 0.1M NaCl；Pressure ambient NMR sample composition 3mM 15N-labeled PABC; 3mM 15N-labeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O NMR sample composition 3mM unlabeled PABC; 3mM unlabeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O NMR sample composition 3mM unlabeled PABC; 3mM unlabeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 100% D2O NMR sample composition 3mM unlabeled PABC; 3mM N15-labeled peptide; 50mM phosphate buffer; 0.1M NaCl; 1mM NaN3; pH 6.3 \| 90% H2O/10% D2O	Resolution not provided
2K8G Solution structure of RRM2 domain of PABP1 Deposited 2008-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 90–182（93 aa） Fragment：RRM2 domain (UNP residues 90-182)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.1；303 K；Ionic strength (raw mmCIF value) 0.04；Pressure ambient NMR sample composition 1 mM [U-98% 13C; U-98% 15N] PABP1, 20 mM sodium chloride, 20 mM sodium phosphate, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-98% 15N] PABP1, 20 mM sodium chloride, 20 mM sodium phosphate, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM PABP1, 20 mM sodium chloride, 20 mM sodium phosphate, 1 mM DTT, 100% D2O \| 100% D2O	Resolution not provided
2RQG Structure of GSPT1/ERF3A-PABC Deposited 2009-05-08	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 541–623（83 aa） Fragment：PABC DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 0.15M；Pressure AMBIENT NMR sample composition 1 mM [U-98% 13C; U-98% 15N] G1 TO S PHASE TRANSITION 1-1, 1 mM [U-98% 13C; U-98% 15N] POLYADENYLATE-BINDING PROTEIN 1-2, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2RQH Structure of GSPT1/ERF3A-PABC Deposited 2009-05-08	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 541–623（83 aa） Fragment：PABC DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 0.15M；Pressure AMBIENT NMR sample composition 1 mM G1 TO S PHASE TRANSITION 1-1, 1 mM [U-98% 13C; U-98% 15N] POLYADENYLATE-BINDING PROTEIN 1-2, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2X04 Crystal structure of the PABC-TNRC6C complex Deposited 2009-12-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 456–530（75 aa） Fragment：C-TERMINAL DOMAIN (PABC), RESIDUES 456-530	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；0.1 M NA-ACETATE PH 4.6, 200 MM AMMONIUM SULFATE, 30% (W/V) PEG 4000	Resolution 1.49 Å R-free 0.186
2X04 Crystal structure of the PABC-TNRC6C complex Deposited 2009-12-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 456–530（75 aa） Fragment：C-TERMINAL DOMAIN (PABC), RESIDUES 456-530	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；0.1 M NA-ACETATE PH 4.6, 200 MM AMMONIUM SULFATE, 30% (W/V) PEG 4000	Resolution 1.49 Å R-free 0.186
3KTP Structural basis of GW182 recognition by poly(A)-binding protein Deposited 2009-11-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–626（83 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；2.0 M ammonium sulfate, 0.1 M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.50 Å R-free 0.231
3KTR Structural basis of ataxin-2 recognition by poly(A)-binding protein Deposited 2009-11-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–626（83 aa） Fragment：C-terminal domain	Not recorded	CD CADMIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；2.2 M ammonium sulfate, 0.2 M CdCl2, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.70 Å R-free 0.245
3KUJ Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a Deposited 2009-11-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–626（83 aa） Fragment：C-terminal domain	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；295 K；1.4M ammonium sulfate, 0.1M citric acid, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.40 Å R-free 0.223
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 544–617（74 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 544–617（74 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 544–617（74 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 544–617（74 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 544–617（74 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 544–617（74 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 544–617（74 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUR Crystal structure of the MLLE domain of poly(A)-binding protein Deposited 2009-11-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 544–617（74 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.3M ammonium sulfate, 0.5M lithium sulfate, 5% glycerol, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.272
3KUS Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the binding region of Paip2 Deposited 2009-11-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–626（83 aa） Fragment：C-terminal domain	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；2.3M ammonium sulfate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.40 Å R-free 0.205
3KUS Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the binding region of Paip2 Deposited 2009-11-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 544–626（83 aa） Fragment：C-terminal domain	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；2.3M ammonium sulfate, 0.1M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.40 Å R-free 0.205
3KUT Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the binding region of Paip2 Deposited 2009-11-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–626（83 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；2.25M ammonium sulfate, 0.2M KBr, 0.1 M Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.50 Å R-free 0.201
3KUT Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the binding region of Paip2 Deposited 2009-11-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 544–626（83 aa） Fragment：C-terminal domain	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；2.25M ammonium sulfate, 0.2M KBr, 0.1 M Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.50 Å R-free 0.201
3PKN Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif of La-related protein 4 (LARP4) Deposited 2010-11-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 544–626（83 aa） Fragment：MLLE domain (UNP residues 544-626)	Not recorded	SO4 SULFATE ION × 1 IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；0.25 M potassium iodide, 1.9 M ammonium sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.80 Å R-free 0.269
3PKN Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif of La-related protein 4 (LARP4) Deposited 2010-11-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 544–626（83 aa） Fragment：MLLE domain (UNP residues 544-626)	Not recorded	SO4 SULFATE ION × 2 IOD IODIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；0.25 M potassium iodide, 1.9 M ammonium sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.80 Å R-free 0.269
3PTH The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B Deposited 2010-12-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 543–621（79 aa） Fragment：UNP residues 543-621	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；289 K；2 ul protein solution at 43 mg/ml containing the 1.5 fold molar amount of peptide ligand was mixed with 2ul reservoir solution containing 1.5M magnesium sulfate, pH 6.5, VAPOR DIFFUSION, temperature 289K	Resolution 1.70 Å R-free 0.218
4F02 Crystal structure of the PABP-binding site of eIF4G in complex with RRM1-2 of PABP and poly(A) Deposited 2012-05-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 2 PDB declaration: trimeric	Chain A 1–190（190 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；0.03 M Tris, 1.3 M (NH4)2SO4, 5% glycerol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.00 Å R-free 0.230
4F02 Crystal structure of the PABP-binding site of eIF4G in complex with RRM1-2 of PABP and poly(A) Deposited 2012-05-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 2 PDB declaration: trimeric	Chain D 1–190（190 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；0.03 M Tris, 1.3 M (NH4)2SO4, 5% glycerol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.00 Å R-free 0.230
4F25 Crystal structure of the second RRM domain of human PABPC1 at pH 6.0 Deposited 2012-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 99–199（101 aa） Fragment：RRM2 domain (un residues 99-119)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；294 K；25% PEG 1500 and 0.1 M MIB buffer, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.90 Å R-free 0.269
4F26 Crystal structure of the second RRM domain of human PABPC1 a pH 9.0 Deposited 2012-05-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 99–199（101 aa） Fragment：RRM2 domain (un residues 99-119)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；294 K；25% PEG 1500 and 0.1 M MMT buffer , pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.00 Å R-free 0.286
5DX1 Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455) Deposited 2015-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 449–466（18 aa） Fragment：UNP residues 449-466 Chain G 449–466（18 aa） Fragment：UNP residues 449-466	Mutation：Nterminal biotin and aminohexanoic acid, methylated R460 Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Nterminal biotin and aminohexanoic acid, methylated R460 Non-standard monomer：Yes (specific site not provided by mmCIF)	SFG SINEFUNGIN × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.2 M Ammonium Sulfate, 0.1 M Tris pH 8.5, 18% w/v PEG 3350	Resolution 1.93 Å R-free 0.238
5DX1 Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455) Deposited 2015-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 449–466（18 aa） Fragment：UNP residues 449-466 Chain I 449–466（18 aa） Fragment：UNP residues 449-466	Mutation：Nterminal biotin and aminohexanoic acid, methylated R460 Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Nterminal biotin and aminohexanoic acid, methylated R460 Non-standard monomer：Yes (specific site not provided by mmCIF)	SFG SINEFUNGIN × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.2 M Ammonium Sulfate, 0.1 M Tris pH 8.5, 18% w/v PEG 3350	Resolution 1.93 Å R-free 0.238
5DX8 Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455) Deposited 2015-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 449–466（18 aa） Fragment：UNP residues 449-466 Chain F 449–466（18 aa） Fragment：UNP residues 449-466	Mutation：Nterminal biotin and aminohexanoic acid, methylated R455 and R460 Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Nterminal biotin and aminohexanoic acid, methylated R455 and R460 Non-standard monomer：Yes (specific site not provided by mmCIF)	SFG SINEFUNGIN × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.2 M Ammonium Sulfate, 0.1 M Tris pH 8.5, 18% w/v PEG 3350	Resolution 1.94 Å R-free 0.246
5DX8 Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455) Deposited 2015-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 449–466（18 aa） Fragment：UNP residues 449-466 Chain H 449–466（18 aa） Fragment：UNP residues 449-466	Mutation：Nterminal biotin and aminohexanoic acid, methylated R455 and R460 Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Nterminal biotin and aminohexanoic acid, methylated R455 and R460 Non-standard monomer：Yes (specific site not provided by mmCIF)	SFG SINEFUNGIN × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.2 M Ammonium Sulfate, 0.1 M Tris pH 8.5, 18% w/v PEG 3350	Resolution 1.94 Å R-free 0.246
5DXA Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R460) Deposited 2015-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 449–466（18 aa） Fragment：UNP residues 449-466 Chain G 449–466（18 aa） Fragment：UNP residues 449-466	Mutation：Nterminal biotin and aminohexanoic acid, methylated R460, asymmetrically dimethylated R455 Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Nterminal biotin and aminohexanoic acid, methylated R460, asymmetrically dimethylated R455 Non-standard monomer：Yes (specific site not provided by mmCIF)	SFG SINEFUNGIN × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.2 M Ammonium Sulfate, 0.1 M Tris pH 8.5, 18% w/v PEG 3350	Resolution 2.07 Å R-free 0.244
5DXA Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R460) Deposited 2015-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 449–466（18 aa） Fragment：UNP residues 449-466	Mutation：Nterminal biotin and aminohexanoic acid, methylated R460, asymmetrically dimethylated R455 Non-standard monomer：Yes (specific site not provided by mmCIF)	SFG SINEFUNGIN × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；0.2 M Ammonium Sulfate, 0.1 M Tris pH 8.5, 18% w/v PEG 3350	Resolution 2.07 Å R-free 0.244
5LGQ Crystal structure of mouse CARM1 in complex with ligand P2C3s Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 456–466（11 aa） Chain F 456–466（11 aa） Chain G 456–466（11 aa） Chain H 456–466（11 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 7 PEG DI(HYDROXYETHYL)ETHER × 4 DXE 1,2-DIMETHOXYETHANE × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1 SO4 SULFATE ION × 1 8ZB (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-propyl-oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris-HCl pH 8.5 14% PEG 3350 200 mM A.S.	Resolution 2.11 Å R-free 0.236
5LGR Crystal structure of mouse CARM1 in complex with ligand P1C3u Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 447–458（12 aa） Chain F 447–458（12 aa） Chain G 447–458（12 aa） Chain H 447–458（12 aa）	Not recorded	SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 6 DXE 1,2-DIMETHOXYETHANE × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1 PEG DI(HYDROXYETHYL)ETHER × 1 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4 LPD L-PROLINAMIDE × 4 ACE ACETYL GROUP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；Tris-HCl pH 8.5 100 mM PEG 3350 14 % Ammonium Sulfate 200 mM	Resolution 2.00 Å R-free 0.234
5LGS Crystal structure of mouse CARM1 in complex with ligand P2C3u Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 456–464（9 aa） Chain F 456–464（9 aa） Chain G 456–464（9 aa） Chain H 456–464（9 aa）	Not recorded	SO4 SULFATE ION × 1 DXE 1,2-DIMETHOXYETHANE × 3 PEG DI(HYDROXYETHYL)ETHER × 1 PG4 TETRAETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 3 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.5 100 mM PEG 3350 20 % A.S. 200 mM	Resolution 2.10 Å R-free 0.215
7BN3 Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from Human Coronavirus 229E Deposited 2021-01-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 455–537（83 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES sodium salt pH-6.5, 1.8 M Ammonium Sulfate	Resolution 1.93 Å R-free 0.228
7BN3 Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from Human Coronavirus 229E Deposited 2021-01-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 455–537（83 aa）	Not recorded	SO4 SULFATE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES sodium salt pH-6.5, 1.8 M Ammonium Sulfate	Resolution 1.93 Å R-free 0.228
7BN3 Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from Human Coronavirus 229E Deposited 2021-01-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 455–537（83 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES sodium salt pH-6.5, 1.8 M Ammonium Sulfate	Resolution 1.93 Å R-free 0.228
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 556–626（71 aa） Fragment：MLLE domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 556–626（71 aa） Fragment：MLLE domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 556–626（71 aa） Fragment：MLLE domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 556–626（71 aa） Fragment：MLLE domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 556–626（71 aa） Fragment：MLLE domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 556–626（71 aa） Fragment：MLLE domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 556–626（71 aa） Fragment：MLLE domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292
8SMO Crystal structure of the complex between truncated MLLE domain of PABPC1 and engineered superPAM2 peptide Deposited 2023-04-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 556–626（71 aa） Fragment：MLLE domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；0.1 M citric acid pH 4.0, 1.6 M ammonium sulfate	Resolution 3.00 Å R-free 0.292

27 other PDB entries and 58 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PABP1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–88； UniProt 544–626

GSPT1 protein

OrganismNot specified

UniProt Q96GF2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 64–78	Fragment：PABPC1-binding region	Polyadenylate-binding protein 1 × 1 （P11940） ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.4；295 K；2.1M ammonium sulfate, 0.2M sodium sulfate, 10mM zinc chloride, 0.1M sodium acetate, pH 5.4, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.30 Å R-free 0.255

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 3KUI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3KUJ Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a Deposited 2009-11-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 73–87（15 aa） Fragment：PABPC1-binding region	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；295 K；1.4M ammonium sulfate, 0.1M citric acid, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.40 Å R-free 0.223

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q96GF2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–15； UniProt 64–78

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3kui
Deposition date deposition_date	2009-11-27
Structure title title	Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
Keywords keywords	;protein-protein complex, Acetylation, Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, GTP-binding, Nucleotide-binding, PROTEIN BINDING ;; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.85 Å
Radius of gyration Rg (electron density) rg_electron	13.65 Å
Forward intensity I(0) i0	2268530.00
Molecular weight molecular_weight	10266.0 kDa
Excluded volume excluded_volume	12838 Å³
Envelope volume envelope_volume	14578 Å³
Hydration-shell volume shell_volume	9826 Å³
Envelope diameter envelope_diameter	52.8 Å
Shell Rg shell_rg	18.31 Å
Envelope Rg envelope_rg	13.98 Å
Shape Rg shape_rg	13.62 Å
Total Rg total_rg	14.77 Å
Total atoms total_atoms	713
Residues n_residues	94
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	52.9 Å
Rg (real space) rg_real	14.87 Å
Rg uncertainty (real space) rg_real_error	0.33 Å
I(0) (real space) i0_real	2.2690e+06
I(0) uncertainty (real space) i0_real_error	2.5560e+04
Rg (reciprocal space) rg_reciprocal	14.87 Å
I(0) (reciprocal space) i0_reciprocal	2269000.0000
Solution quality estimate total_estimate	0.8329
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	16.7 Å
Skewness Skewness skewness	0.416
Kurtosis Kurtosis kurtosis	0.087
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	303600.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.646; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.944; Smooth: 0.940

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Polyadenylate-binding protein 1
Molecular weight formula_weight	9421.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	729

GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	GSPT1 protein
Molecular weight formula_weight	1736.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

RQLNVNAKPFVPNVH

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	16

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	3kuiA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1900 — c-terminal domain of poly(a) binding protein
Homologous superfamily homologous superfamily	10 — c-terminal domain of poly(a) binding protein

▶

8. Citations (1)

▶

Unit-cell length a length_a	37.432 Å
Unit-cell length b length_b	63.631 Å
Unit-cell length c length_c	32.226 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2480
R_work r_work	0.2470
R_free r_free	0.2550

fit	/app/data/saxs_computation/ku/3kui/3kui.fit
pddf	/app/data/pr_computation/ku/3kui/3kui.pr.out
profile	/app/data/saxs_computation/ku/3kui/3kui.dat

Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polyadenylate-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

GSPT1 protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)