3lde

High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in 100 mM Na+.

Method: X-RAY DIFFRACTION D_max: 50.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 18–99	Fragment：MthK K+ channel, residues 28-99 Mutation：S68H, V77C	NA SODIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；3.0-3.5 M 1,6-Hexandiol, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.21 Å R-free 0.208

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3LDE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1LNQ CRYSTAL STRUCTURE OF MTHK AT 3.3 A Deposited 2002-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；PEGMME350, CaCl2, MES, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.30 Å R-free 0.318
2AEF Crystal Structures of the MthK RCK Domain in Ca2+ bound form Deposited 2005-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：isoform Soluble Chain B 107–336（230 aa） Fragment：isoform Soluble	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；PEG 4000, calcium chloride, Ammonium formate, sodium acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.70 Å R-free 0.268
2AEJ Crystal Structures of the MthK RCK Domain in no Ca2+ bound form Deposited 2005-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：isoform Soluble Chain B 107–336（230 aa） Fragment：isoform Soluble	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；PEG 4000, Ammonium formate, sodium acetate , pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.10 Å R-free 0.245
2AEM Crystal Structures of the MthK RCK Domain Deposited 2005-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；PEG 400, Ammonium sulfate, cacodylate , pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.80 Å R-free 0.263
2FY8 Crystal structure of MthK rck domain in its ligand-free gating-ring form Deposited 2006-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 107–336（230 aa） Fragment：soluble isoform, residues 107-336 Chain B 107–336（230 aa） Fragment：soluble isoform, residues 107-336 Chain C 107–336（230 aa） Fragment：soluble isoform, residues 107-336 Chain D 107–336（230 aa） Fragment：soluble isoform, residues 107-336	Mutation：D184N Mutation：D184N Mutation：D184N Mutation：D184N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；0.6 M Na/K PO4, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.79 Å R-free 0.254
2FY8 Crystal structure of MthK rck domain in its ligand-free gating-ring form Deposited 2006-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain E 107–336（230 aa） Fragment：soluble isoform, residues 107-336 Chain F 107–336（230 aa） Fragment：soluble isoform, residues 107-336 Chain G 107–336（230 aa） Fragment：soluble isoform, residues 107-336 Chain H 107–336（230 aa） Fragment：soluble isoform, residues 107-336	Mutation：D184N Mutation：D184N Mutation：D184N Mutation：D184N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；0.6 M Na/K PO4, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.79 Å R-free 0.254
2OGU Crystal structure of the isolated MthK RCK domain Deposited 2007-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：RCK domain: Residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1M Sodium cacodylate pH 6.5, 1.3-1.5M Lithium sulfate, 2% Benzamidine-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.23 Å R-free 0.299
2OGU Crystal structure of the isolated MthK RCK domain Deposited 2007-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 107–336（230 aa） Fragment：RCK domain: Residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1M Sodium cacodylate pH 6.5, 1.3-1.5M Lithium sulfate, 2% Benzamidine-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.23 Å R-free 0.299
3KXD Crystal structure of the mthk rck in complex with cadmium Deposited 2009-12-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 116–336（221 aa） Fragment：RCK DOMAIN Chain B 116–336（221 aa） Fragment：RCK DOMAIN	Not recorded	CD CADMIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.7；318 K；1M NH4-FORMATE, 10% PEG 4000, 0.1M NA ACETATE, PH 4.7, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 318K	Resolution 2.20 Å R-free 0.254
3LDC High resolution open MthK pore structure crystallized in 100 mM K+ Deposited 2010-01-12	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：MthK K+ channel, residues 28-99	Mutation：S68H, V77C	K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；3.0-3.5 M 1,6-Hexandiol, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.45 Å R-free 0.202
3LDD High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in 99 mM Na+/1 mM K+. Deposited 2010-01-12	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：MthK K+ channel, residues 28-99	Mutation：S68R, V77C	K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；3.0-3.5 M 1,6-Hexandiol, 100 mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.45 Å R-free 0.216
3OUS MthK channel pore T59A mutant Deposited 2010-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa）	Mutation：T59A	K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；1M 1,6-hexanediol, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.75 Å R-free 0.236
3R65 MthK channel pore E92Q mutant Deposited 2011-03-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：CALCIUM-GATED POTASSIUM CHANNEL MTHK PORE (UNP Residues 18-99)	Mutation：E92Q	K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；3.0-3.5 M 1,6-Hexandiol, 100 mM MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.80 Å R-free 0.225
3RBX MthK RCK domain D184N mutant, Ca2+-bound Deposited 2011-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：unp residues 107-336 Chain B 107–336（230 aa） Fragment：unp residues 107-336	Mutation：D184N Mutation：D184N	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.7；295 K；20% PEG 3350, 0.1 M CaCl2, 0.1 M MES, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K, pH 5.7	Resolution 2.80 Å R-free 0.274
3RBX MthK RCK domain D184N mutant, Ca2+-bound Deposited 2011-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 107–336（230 aa） Fragment：unp residues 107-336 Chain D 107–336（230 aa） Fragment：unp residues 107-336	Mutation：D184N Mutation：D184N	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.7；295 K；20% PEG 3350, 0.1 M CaCl2, 0.1 M MES, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K, pH 5.7	Resolution 2.80 Å R-free 0.274
3RBX MthK RCK domain D184N mutant, Ca2+-bound Deposited 2011-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 107–336（230 aa） Fragment：unp residues 107-336 Chain F 107–336（230 aa） Fragment：unp residues 107-336	Mutation：D184N Mutation：D184N	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.7；295 K；20% PEG 3350, 0.1 M CaCl2, 0.1 M MES, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K, pH 5.7	Resolution 2.80 Å R-free 0.274
3RBZ MthK channel, Ca2+-bound Deposited 2011-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa）	Mutation：G85A, E92A, E96T, M107I Mutation：G85A, E92A, E96T, M107I Mutation：G85A, E92A, E96T, M107I Mutation：G85A, E92A, E96T, M107I	CA CALCIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；26% PEG 350-MME, 0.2 M CaCl2, 0.1 M MES, VAPOR DIFFUSION, HANGING DROP, temperature 295K, pH 6.5	Resolution 3.40 Å R-free 0.288
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain L 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 13 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain M 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 14 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain N 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 15 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain O 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 16 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain P 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4EI2 Crystal Structures of MthK RCK gating ring bound to Barium Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 107–336（230 aa） Fragment：residues 115-336	Not recorded	BA BARIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；295 K；28% polyethylene glycol (PEG) 300, 100 mM BaCl2, 100 mM Tris, pH 8.5, VAPOR DIFFUSION, temperature 295 K	Resolution 3.11 Å R-free 0.242
4HYO Crystal Structure of MthK Pore Deposited 2012-11-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 11–101（91 aa） Fragment：unp residues 11-101 Chain B 11–101（91 aa） Fragment：unp residues 11-101 Chain C 11–101（91 aa） Fragment：unp residues 11-101 Chain D 11–101（91 aa） Fragment：unp residues 11-101	Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C	K POTASSIUM ION × 4 HEZ HEXANE-1,6-DIOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；3.5-4.0M 1,6-hexanediol, 100mM MES , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.65 Å R-free 0.181
4HYO Crystal Structure of MthK Pore Deposited 2012-11-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 11–101（91 aa） Fragment：unp residues 11-101 Chain F 11–101（91 aa） Fragment：unp residues 11-101 Chain G 11–101（91 aa） Fragment：unp residues 11-101 Chain H 11–101（91 aa） Fragment：unp residues 11-101	Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C	K POTASSIUM ION × 4 HEZ HEXANE-1,6-DIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；3.5-4.0M 1,6-hexanediol, 100mM MES , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.65 Å R-free 0.181
4HZ3 MthK pore crystallized in presence of TBSb Deposited 2012-11-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 11–101（91 aa） Fragment：unp residues 11-101 Chain B 11–101（91 aa） Fragment：unp residues 11-101 Chain C 11–101（91 aa） Fragment：unp residues 11-101 Chain D 11–101（91 aa） Fragment：unp residues 11-101	Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C	K POTASSIUM ION × 4 HEZ HEXANE-1,6-DIOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；3.5 4.0M 1,6-hexanediol, 100mM MES, 10mM TBSb , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.70 Å R-free 0.192
4HZ3 MthK pore crystallized in presence of TBSb Deposited 2012-11-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 11–101（91 aa） Fragment：unp residues 11-101 Chain F 11–101（91 aa） Fragment：unp residues 11-101 Chain G 11–101（91 aa） Fragment：unp residues 11-101 Chain H 11–101（91 aa） Fragment：unp residues 11-101	Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C Mutation：S68H, V77C	K POTASSIUM ION × 4 HEZ HEXANE-1,6-DIOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；3.5 4.0M 1,6-hexanediol, 100mM MES, 10mM TBSb , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.70 Å R-free 0.192
4L73 Ca2+-bound MthK RCK domain at 2.5 Angstrom Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain B 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Not recorded	CA CALCIUM ION × 5 NA SODIUM ION × 8 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；12% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 1 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.50 Å R-free 0.226
4L74 Ca2+-bound MthK RCK domain at 1.9 Angstrom with single ligand Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain B 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；6% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.2 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.84 Å R-free 0.253
4L75 Ca2+-bound D184N mutant MthK RCK domain at 2.4 Angstrom Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain B 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Mutation：D184N Mutation：D184N	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；7% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.3 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.39 Å R-free 0.245
4L75 Ca2+-bound D184N mutant MthK RCK domain at 2.4 Angstrom Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain D 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Mutation：D184N Mutation：D184N	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；7% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.3 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.39 Å R-free 0.245
4L75 Ca2+-bound D184N mutant MthK RCK domain at 2.4 Angstrom Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain F 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Mutation：D184N Mutation：D184N	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；7% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.3 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.39 Å R-free 0.245
4L76 Ca2+-bound E212Q mutant MthK RCK domain Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain B 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Mutation：E212Q Mutation：E212Q	CA CALCIUM ION × 4 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；8% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.2 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.99 Å R-free 0.263
4L76 Ca2+-bound E212Q mutant MthK RCK domain Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain D 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Mutation：E212Q Mutation：E212Q	CA CALCIUM ION × 5 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；8% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.2 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.99 Å R-free 0.263
4L76 Ca2+-bound E212Q mutant MthK RCK domain Deposited 2013-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336) Chain F 107–336（230 aa） Fragment：RCK domain (UNP residues 107-336)	Mutation：E212Q Mutation：E212Q	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；295 K；8% PEG4000, 1 M ammonium formate, 0.1 M sodium acetate, pH 4.8, 0.2 M calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.99 Å R-free 0.263
4QE7 Open MthK pore structure soaked in 10 mM Ba2+/100 mM Na+ Deposited 2014-05-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 19–99（81 aa） Fragment：UNP residues 19-99	Mutation：S68H, V77C	BA BARIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；3.0-3.5M 1,6-Hexandiol, 100mM Hepes, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.40 Å R-free 0.265
4QE9 Open MthK pore structure soaked in 10 mM Ba2+/100 mM K+ Deposited 2014-05-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–100（83 aa） Fragment：UNP residues 18-100	Mutation：S51H, V60C	K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；3.0-3.5M 1,6-Hexandiol, 100mM HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.15 Å R-free 0.257
4RO0 Crystal structure of MthK gating ring in a ligand-free form Deposited 2014-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain B 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain C 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain D 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain a 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain b 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain c 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain d 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.4 M KCl, 0.1 M Tris and 20-25% PEGMME 350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.18 Å R-free 0.301
4RO0 Crystal structure of MthK gating ring in a ligand-free form Deposited 2014-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain E 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain F 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain G 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain H 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain e 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain f 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain g 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain h 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.4 M KCl, 0.1 M Tris and 20-25% PEGMME 350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.18 Å R-free 0.301
4RO0 Crystal structure of MthK gating ring in a ligand-free form Deposited 2014-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain I 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain J 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain K 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain L 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain i 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain j 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain k 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain l 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.4 M KCl, 0.1 M Tris and 20-25% PEGMME 350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.18 Å R-free 0.301
4RO0 Crystal structure of MthK gating ring in a ligand-free form Deposited 2014-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain M 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain N 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain O 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain P 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain m 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain n 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain o 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain p 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.4 M KCl, 0.1 M Tris and 20-25% PEGMME 350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.18 Å R-free 0.301
4RO0 Crystal structure of MthK gating ring in a ligand-free form Deposited 2014-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain Q 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain R 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain S 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain T 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain q 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain r 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain s 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336 Chain t 107–336（230 aa） Fragment：MthK RCK, UNP residues 107-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.4 M KCl, 0.1 M Tris and 20-25% PEGMME 350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.18 Å R-free 0.301
5BKI Blocker-free closed MthK channel in nanodisc Deposited 2021-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CD CADMIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
5BKJ TPeA-bound closed MthK channel in nanodisc Deposited 2021-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 2 YQ1 1-(tripentyl-$l^{4}-azanyl)pentane × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
5BKK bbTBA-bound closed MthK channel in nanodisc Deposited 2021-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 K POTASSIUM ION × 3 YQ4 (~{R})-phenyl-[4-[(tributyl-$l^{4}-azanyl)methyl]phenyl]methanol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6OLY Full-length MthK channel at 3.1 angstrom resolution Deposited 2019-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa）	Mutation：M107I Mutation：M107I Mutation：M107I Mutation：M107I	CA CALCIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；300 K；28% PEG350-MME, 0.1M MES pH 6.5, 0.2 M CaCl2	Resolution 3.11 Å R-free 0.275
6U5N Calcium-bound MthK gating ring state 2 Deposited 2019-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CA CALCIUM ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；blotting for 2 seconds (blot force 0)	Resolution 3.20 Å
6U5P Calcium-bound MthK gating ring state 1 Deposited 2019-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CA CALCIUM ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；blotting for 2 seconds (blot force 0)	Resolution 3.30 Å
6U5R Calcium-bound MthK closed state Deposited 2019-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；blotting for 2 seconds (blot force 0)	Resolution 3.60 Å
6U68 Calcium-bound MthK open-inactivated state 1 Deposited 2019-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；blotting for 2 s (blot force 0)	Resolution 4.50 Å
6U6D MthK closed state with EDTA Deposited 2019-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；blotting for 2 s (blot force 0)	Resolution 3.60 Å
6U6E Calcium-bound MthK open-inactivated state 2 Deposited 2019-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
6U6H Calcium-bound MthK open-inactivated state 3 Deposited 2019-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.00 Å
6U9P Wild-type MthK pore in ~150 mM K+ Deposited 2019-09-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：UNP residues 18-99	Not recorded	K POTASSIUM ION × 20 HEZ HEXANE-1,6-DIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1:1 protein (in 100 mM potassium chloride, 10 mM MOPS-KOH, pH 8.0) + 3.5-4.0 M 1,6-hexanediol, 100 mM MES-KOH, pH 6.75	Resolution 1.65 Å R-free 0.207
6U9T Wild-type MthK pore in 50 mM K+ Deposited 2019-09-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：UNP residues 18-99	Not recorded	K POTASSIUM ION × 20 HEZ HEXANE-1,6-DIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1:1 protein (in 100 mM sodium chloride, 1 mM potassium chloride, 10 mM MOPS, pH 8.0) + 3.5-4.0 M 1,6-hexanediol, 100 mM MES-NaOH, pH 6.75	Resolution 1.55 Å R-free 0.210
6U9Y Wild-type MthK pore in 11 mM K+ Deposited 2019-09-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：UNP residues 18-99	Mutation：UNP residues 18-99	K POTASSIUM ION × 20 HEZ HEXANE-1,6-DIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；1:1 protein (in 100 mM sodium chloride, 1 mM potassium chloride, 10 mM MOPS, pH 8.0) + 3.5-4.0 M 1,6-hexanediol, 100 mM MES-NaOH, 10 mM potassium chloride	Resolution 1.80 Å R-free 0.217
6U9Z Wild-type MthK pore in 6 mM K+ Deposited 2019-09-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 18–99（82 aa） Fragment：UNP residues 18-99	Not recorded	K POTASSIUM ION × 20 HEZ HEXANE-1,6-DIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；protein (in 100 mM sodium chloride, 1 mM potassium chloride, 10 mM MOPS) + 3.5-4.0 M 1,6-hexanediol, 100 mM MES-NaOH, pH 6.75, 5 mM potassium chloride	Resolution 1.95 Å R-free 0.226
6UWN MthK N-terminal truncation RCK domain state 1 bound with calcium Deposited 2019-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CA CALCIUM ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6UX4 MthK N-terminal truncation RCK domain state 2 bound with calcium Deposited 2019-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	CA CALCIUM ION × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6UX7 MthK N-terminal truncation state 1 bound with calcium Deposited 2019-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.70 Å
6UXA MthK N-terminal truncation state 2 bound with calcium Deposited 2019-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6UXB MthK N-terminal truncation state 3 bound with calcium Deposited 2019-11-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.90 Å
8DJB MthK-A90L mutant in closed state with 0 Ca2+ Deposited 2022-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；BLOTTING FOR 2 S (BLOT FORCE 1)	Resolution 3.18 Å
8FZ7 TpeA bound closed MthK-A88F mutant in nanodisc Deposited 2023-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 YQ1 1-(tripentyl-$l^{4}-azanyl)pentane × 1 K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；BLOTTING FOR 2 S (BLOT FORCE 0)	Resolution 2.88 Å
9Z2M Ca2+-bound MthK WT in lipid nanodiscs composed of 14:1PC (75%) and POPG (25%) Deposited 2025-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5；20 mM HEPES-KOH pH 8.5 100 mM KCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9Z2V Ca2+-bound MthK WT in lipid nanodiscs composed of 22:1PC (75%) and POPG (25%) Deposited 2025-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–336（336 aa） Chain B 1–336（336 aa） Chain C 1–336（336 aa） Chain D 1–336（336 aa） Chain E 1–336（336 aa） Chain F 1–336（336 aa） Chain G 1–336（336 aa） Chain H 1–336（336 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5；20 mM HEPES-KOH pH 8.5 100 mM KCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å

47 other PDB entries and 76 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MTHK_METTH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–82； UniProt 18–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3lde
Deposition date deposition_date	2010-01-12
Structure title title	High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in 100 mM Na+.
Keywords keywords	;transmembrane, ion channel, open conformation, potassium, ion transport, Alternative initiation, Cell membrane, Ionic channel, Membrane, Metal-binding, Potassium transport, Transport, TRANSPORT PROTEIN ;; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.34 Å
Radius of gyration Rg (electron density) rg_electron	13.45 Å
Forward intensity I(0) i0	1315230.00
Molecular weight molecular_weight	9103.0 kDa
Excluded volume excluded_volume	11989 Å³
Envelope volume envelope_volume	13074 Å³
Hydration-shell volume shell_volume	8928 Å³
Envelope diameter envelope_diameter	48.7 Å
Shell Rg shell_rg	18.05 Å
Envelope Rg envelope_rg	13.87 Å
Shape Rg shape_rg	13.42 Å
Total Rg total_rg	14.81 Å
Total atoms total_atoms	644
Residues n_residues	82
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	50.0 Å
Rg (real space) rg_real	14.42 Å
Rg uncertainty (real space) rg_real_error	0.37 Å
I(0) (real space) i0_real	1.3150e+06
I(0) uncertainty (real space) i0_real_error	1.5860e+04
Rg (reciprocal space) rg_reciprocal	14.41 Å
I(0) (reciprocal space) i0_reciprocal	1315000.0000
Solution quality estimate total_estimate	0.8334
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	14.6 Å
Skewness Skewness skewness	0.448
Kurtosis Kurtosis kurtosis	-0.303
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	174000.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.679; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.807; Smooth: 0.987

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Calcium-gated potassium channel mthK
Molecular weight formula_weight	9034.6 kDa
Mutation mutation	S68H, V77C
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	675

VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI

来源 Source

来源生物 organism	Methanothermobacter thermautotrophicus
NCBI Class编号 ncbi_taxonomy_id	187420
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	27

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	3ldeA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	60.818 Å
Unit-cell length b length_b	60.818 Å
Unit-cell length c length_c	44.776 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	—

Resolution resolution	2.208 Å
Low-resolution limit resolution_low	31.020 Å
R factor r_factor	0.2026
R_work r_work	0.2020
R_free r_free	0.2076

fit	/app/data/saxs_computation/ld/3lde/3lde.fit
pddf	/app/data/pr_computation/ld/3lde/3lde.pr.out
profile	/app/data/saxs_computation/ld/3lde/3lde.dat