SAXSdb — 3p33

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	PHENOL × 3 ZINC ION × 3 CHLORIDE ION × 3 water × 6	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 6	PHENOL × 3 ZINC ION × 3 CHLORIDE ION × 3 water × 6	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 6	PHENOL × 3 ZINC ION × 3 CHLORIDE ION × 3 water × 6	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 6	PHENOL × 3 ZINC ION × 3 CHLORIDE ION × 3 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INS_HUMAN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–21； UniProt 90–110 Author chain C； PDBConstruct 1–21； UniProt 90–110 Author chain E； PDBConstruct 1–21； UniProt 90–110 Author chain G； PDBConstruct 1–21； UniProt 90–110 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54 Author chain F； PDBConstruct 1–30； UniProt 25–54 Author chain H； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3p33
Deposition date deposition_date	2010-10-04
Structure title title	Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity
Keywords keywords	zinc-binding site, long-acting insulin analog, receptor binding protein engineering, global health, insulin fibrillation, HORMONE; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3p33__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3p33__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3p33__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.09 Å
Rg (electron density)	17.05 Å
Total Rg	17.85 Å
Atom count	1238
Residues	153
Excluded volume	22101 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3p33__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3p33__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3p33__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3p33__assembly_4__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Insulin
Molecular weight formula_weight	2383.7 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	1746

GIVEQCCTSICSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	Insulin
Molecular weight formula_weight	3434.0 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Entity 3 Entity 3 non-polymer

Description description	PHENOL
Molecular weight formula_weight	94.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	90

▶

7. Citations (7)

Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity

To be Published

PRIMARY

;Diabetes-associated mutations in human insulin: crystal structure and photo-cross-linking studies of a-chain variant insulin Wakayama. ;

Biochemistry (2005)

PMID: 15794638 · DOI: 10.1021/bi047585k

;Enhancing the activity of insulin at the receptor interface: crystal structure and photo-cross-linking of A8 analogues. ;

Biochemistry (2004)

PMID: 15610006 · DOI: 10.1021/bi048223f

;Crystal structure of allo-Ile(A2)-insulin, an inactive chiral analogue: implications for the mechanism of receptor binding ;

Biochemistry (2003)

PMID: 14596591 · DOI: 10.1021/bi034430o

Phenol stabilizes more helix in a new symmetrical zinc insulin hexamer

Nature (1989)

PMID: 2648161 · DOI: 10.1038/338594a0

The structure of 2zn pig insulin crystal at 1.5 A resolution

Philos.Trans.R.Soc.London,Ser.B (1988)

PMID: 2905485 · DOI: 10.1098/rstb.1988.0058

Structure of insulin in 4-zinc insulin

Nature (1976)

PMID: 1272390

Unit-cell length a length_a	77.900 Å
Unit-cell length b length_b	77.900 Å
Unit-cell length c length_c	78.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	51.110 Å
R factor r_factor	—
R_work r_work	0.2140
R_free r_free	0.2990

Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3p33__assembly_1__model_1

3p33__assembly_1__model_1 | I(q)

3p33__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (7)

Insulin fibrillation is the Janus face of induced fit. A chiral clamp stabilizes the native state at the expense of activity

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3p33__assembly_1__model_1

3p33__assembly_1__model_1 | I(q)

3p33__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (7)