3p9h

Crystal structure of the TSG101 UEV domain in complex with FA258 peptide

Method: X-RAY DIFFRACTION D_max: 53.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor susceptibility gene 101 protein

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 2–145	Fragment：N-terminal UEV domain (UNP residues 2 to 145) Mutation：Mutation of 43VFNDGS48 to GG	Gag polyprotein × 1 （Q9YP46）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NAOH (PH7.5), 25% PEG 3350, 0.2M SODIUM NITRATE , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3P9H	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1KPP Structure of the Tsg101 UEV domain Deposited 2002-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；293 K；Ionic strength (raw mmCIF value) 50 mM NaCl；Pressure ambient NMR sample composition ~1.5 mM Tsg101 UEV; 20 mM sodium phosphate pH 5.5; 50 mM NaCl \| 90% H2O/10% D2O	Resolution not provided
1KPQ Structure of the Tsg101 UEV domain Deposited 2002-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；293 K；Ionic strength (raw mmCIF value) 50 mM NaCl；Pressure ambient NMR sample composition ~1.5 mM Tsg101 UEV; 20 mM sodium phosphate pH 5.5; 50 mM NaCl \| 90% H2O/10% D2O	Resolution not provided
1M4P Structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP "late domain" peptide, DYANA Ensemble Deposited 2002-07-03	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–145（145 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1M4Q STRUCTURE OF THE TSG101 UEV DOMAIN IN COMPLEX WITH A HIV-1 PTAP "LATE DOMAIN" PEPTIDE, CNS ENSEMBLE Deposited 2002-07-03	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–145（145 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1S1Q TSG101(UEV) domain in complex with Ubiquitin Deposited 2004-01-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–145（145 aa） Fragment：TSG101(UEV) domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	CU COPPER (II) ION × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；1.4M Ammonium sulfate, 0.1M sodium acetate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.00 Å R-free 0.240
1S1Q TSG101(UEV) domain in complex with Ubiquitin Deposited 2004-01-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–145（145 aa） Fragment：TSG101(UEV) domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	CU COPPER (II) ION × 2 SO4 SULFATE ION × 2 ACY ACETIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；1.4M Ammonium sulfate, 0.1M sodium acetate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.00 Å R-free 0.240
2F0R Crystallographic structure of human Tsg101 UEV domain Deposited 2005-11-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–145（145 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；288 K；20% PEG 4000, 0.2 M ammonium sulphate, 0.1 M Tris , pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 288K	Resolution 2.26 Å R-free 0.243
2F0R Crystallographic structure of human Tsg101 UEV domain Deposited 2005-11-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–145（145 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；288 K；20% PEG 4000, 0.2 M ammonium sulphate, 0.1 M Tris , pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 288K	Resolution 2.26 Å R-free 0.243
3IV1 Coiled-coil domain of tumor susceptibility gene 101 Deposited 2009-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 229–304（76 aa） Fragment：COILED-COIL DOMAIN Chain B 229–304（76 aa） Fragment：COILED-COIL DOMAIN Chain C 229–304（76 aa） Fragment：COILED-COIL DOMAIN Chain D 229–304（76 aa） Fragment：COILED-COIL DOMAIN	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 1 CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；2.4 M AMMONIUM SULFATE, 0.1 M BIS-TRIS, 1 mM DTT, pH 5.50, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.50 Å R-free 0.277
3IV1 Coiled-coil domain of tumor susceptibility gene 101 Deposited 2009-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 229–304（76 aa） Fragment：COILED-COIL DOMAIN Chain F 229–304（76 aa） Fragment：COILED-COIL DOMAIN	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；2.4 M AMMONIUM SULFATE, 0.1 M BIS-TRIS, 1 mM DTT, pH 5.50, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.50 Å R-free 0.277
3IV1 Coiled-coil domain of tumor susceptibility gene 101 Deposited 2009-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain G 229–304（76 aa） Fragment：COILED-COIL DOMAIN Chain H 229–304（76 aa） Fragment：COILED-COIL DOMAIN	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；2.4 M AMMONIUM SULFATE, 0.1 M BIS-TRIS, 1 mM DTT, pH 5.50, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.50 Å R-free 0.277
3OBQ Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide Deposited 2010-08-09	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–145（144 aa） Fragment：N-terminal UEV domain (UNP residues 2 to 145)	Mutation：43VFNDGS48 -> GTG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NaOH (pH 7.5), 25% PEG 3350, 0.2M Sodium Nitrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.40 Å R-free 0.224
3OBS Crystal structure of Tsg101 UEV domain Deposited 2010-08-09	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–145（144 aa） Fragment：N-terminal UEV domain (UNP residues 2 to 145)	Mutation：43VFNDGS48 -> GTG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NaOH (pH 7.5), 25% PEG 3350, 0.2M Sodium Nitrate , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.232
3OBU Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide Deposited 2010-08-09	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–145（144 aa） Fragment：N-terminal UEV domain (UNP residues 2 to 145)	Mutation：43VFNDGS48 -> GTG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NaOH (pH7.5), 25% PEG 3350, 0.2M Sodium Nitrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.60 Å R-free 0.236
3OBX Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide Deposited 2010-08-09	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–145（144 aa） Fragment：N-terminal UEV domain (UNP residues 2 to 145)	Mutation：43VFNDGS48 -> GTG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NaOH (pH7.5), 25% PEG 3350, 0.2M Sodium Nitrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.60 Å R-free 0.230
3P9G Crystal structure of the TSG101 UEV domain in complex with FA459 peptide Deposited 2010-10-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–145（144 aa） Fragment：N-TERMINAL UEV DOMAIN (UNP resiudes 2 to 145)	Mutation：Mutation of 43VFNDGS48 to GG	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NAOH (PH7.5), 25% PEG 3350, 0.2M SODIUM NITRATE, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.242
4EJE Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide Deposited 2012-04-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–145（145 aa） Fragment：UEV domain (UNP Residues 1-145)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；0.1 M of ammonium sulphate, 25% PEG 4K, 25% 0.1 M Hepes, pH 7.0, vapor diffusion, hanging drop, temperature 278K	Resolution 2.20 Å R-free 0.274
4EJE Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide Deposited 2012-04-06	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–145（145 aa） Fragment：UEV domain (UNP Residues 1-145)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；0.1 M of ammonium sulphate, 25% PEG 4K, 25% 0.1 M Hepes, pH 7.0, vapor diffusion, hanging drop, temperature 278K	Resolution 2.20 Å R-free 0.274
4YC1 Structure of the human TSG101-UEV domain in the P321 space group Deposited 2015-02-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；25% PEG4k, 0.2 Ammonium sulphate, 0.1 M Sodium Acetate	Resolution 2.00 Å R-free 0.197
4YC1 Structure of the human TSG101-UEV domain in the P321 space group Deposited 2015-02-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；25% PEG4k, 0.2 Ammonium sulphate, 0.1 M Sodium Acetate	Resolution 2.00 Å R-free 0.197
4YC1 Structure of the human TSG101-UEV domain in the P321 space group Deposited 2015-02-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；25% PEG4k, 0.2 Ammonium sulphate, 0.1 M Sodium Acetate	Resolution 2.00 Å R-free 0.197
4ZNY Structure of the human TSG101-UEV Domain in complex with the PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus Deposited 2015-05-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 4–145（142 aa） Fragment：UEV domain	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；30% PEG4k, 0.1 ammonium sulfate, 0.1 MES	Resolution 2.40 Å R-free 0.243
5VKG Solution-state NMR structural ensemble of human Tsg101 UEV in complex with tenatoprazole Deposited 2017-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–145（145 aa）	Mutation：M1G	4N1 4-methoxy-1-(5-methoxy-3H-imidazo[4,5-b]pyridin-2-yl)-3,5-dimethyl-2-(sulfanylmethyl)pyridin-1-ium × 1	SOLUTION NMR NMR measurement conditions pH 5.8；300 K；Ionic strength (raw mmCIF value) 0.1；Pressure 1 NMR measurement conditions pH 5.8；300 K；Ionic strength (raw mmCIF value) 0.1；Pressure 1 NMR sample composition 0.6 mM [U-98% 13C; U-98% 15N] Tsg101, 0.6 mM Tenatoprazole, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 0.6 mM [U-13C; U-15N] Tsg101, 0.6 mM Tenatoprazole, 20 mM potassium phosphate, 50 mM sodium chloride, 100% D2O \| 100% D2O	Resolution not provided
6UD0 Solution-state NMR structural ensemble of human Tsg101 UEV in complex with K63-linked diubiquitin Deposited 2019-09-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–145（145 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.8；300 K；Ionic strength (raw mmCIF value) 0.1；Pressure 1 NMR sample composition 200 uM [U-98% 15N] Tsg101 UEV domain, 200 uM K63-linked diubiquitin, distal domain, 200 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 200 uM K63-linked diubiquitin, distal domain, 200 uM [U-98% 15N] K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 200 uM Tsg101 UEV domain, 200 uM [U-98% 15N] K63-linked diubiquitin, distal domain, 200 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 200 uM Tsg101 UEV domain, 200 uM K63-linked diubiquitin, distal domain, 200 uM [U-98% 15N] K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 125 uM [U-98% 15N] Tsg101 UEV domain, 125 uM K63-linked diubiquitin, distal domain, 125 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 125 uM [U-98% 15N] Tsg101 UEV domain, 125 uM K63-linked diubiquitin, distal domain, 125 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 125 uM [U-98% 15N] Tsg101 UEV domain, 125 uM K63-linked diubiquitin, distal domain, 125 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 125 uM [U-98% 15N] Tsg101 UEV domain, 125 uM K63-linked diubiquitin, distal domain, 125 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 200 uM [U-98% 15N] Tsg101 UEV domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 200 uM [U-98% 15N] K63-linked diubiquitin, distal domain, 200 uM K63-linked diubiquitin, proximal domain, 20 mM potassium phosphate, 50 mM sodium chloride, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
6VME Human ESCRT-I heterotetramer headpiece Deposited 2020-01-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 308–388（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；2 % w/v gamma-Polyglutamic acid (gamma-PGA), 100 mM sodium formate, 100 mM sodium acetate pH 5.0	Resolution 2.19 Å R-free 0.240
6VME Human ESCRT-I heterotetramer headpiece Deposited 2020-01-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 308–388（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；2 % w/v gamma-Polyglutamic acid (gamma-PGA), 100 mM sodium formate, 100 mM sodium acetate pH 5.0	Resolution 2.19 Å R-free 0.240
6VME Human ESCRT-I heterotetramer headpiece Deposited 2020-01-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 308–388（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；2 % w/v gamma-Polyglutamic acid (gamma-PGA), 100 mM sodium formate, 100 mM sodium acetate pH 5.0	Resolution 2.19 Å R-free 0.240
6VME Human ESCRT-I heterotetramer headpiece Deposited 2020-01-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 308–388（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；2 % w/v gamma-Polyglutamic acid (gamma-PGA), 100 mM sodium formate, 100 mM sodium acetate pH 5.0	Resolution 2.19 Å R-free 0.240
6VME Human ESCRT-I heterotetramer headpiece Deposited 2020-01-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain I 308–388（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；2 % w/v gamma-Polyglutamic acid (gamma-PGA), 100 mM sodium formate, 100 mM sodium acetate pH 5.0	Resolution 2.19 Å R-free 0.240
6VME Human ESCRT-I heterotetramer headpiece Deposited 2020-01-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain J 308–388（81 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；2 % w/v gamma-Polyglutamic acid (gamma-PGA), 100 mM sodium formate, 100 mM sodium acetate pH 5.0	Resolution 2.19 Å R-free 0.240
7NLC Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide Deposited 2021-02-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–145（145 aa）	Not recorded	CL CHLORIDE ION × 2 SO4 SULFATE ION × 1 NH4 AMMONIUM ION × 50	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 3.5；288 K；0.1M Citric Acid, 2M Ammonium sulfate pH 3.5, 13.34% glycerol	Resolution 1.40 Å R-free 0.239
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 11 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain L 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244
7ZLX Crystal Structure of the TSG101-UEV domain:space group P21 Deposited 2022-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 1–145（145 aa） Fragment：UEV domain, residues 1-145	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；25 % PEG 4000, 0.25 M Ammonium Sulfate, 0.1 proline, 0.1 M HEPES	Resolution 2.25 Å R-free 0.244

20 other PDB entries and 43 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TS101_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–145； UniProt 2–145

Gag polyprotein

OrganismNot specified

UniProt Q9YP46

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 453–461	Fragment：Modified HIV-1 Gag PTAP Motif Non-standard monomer：Yes (specific site not provided by mmCIF)	Tumor susceptibility gene 101 protein × 1 （Q99816）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NAOH (PH7.5), 25% PEG 3350, 0.2M SODIUM NITRATE , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.253

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 3P9H	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2L44 C-terminal zinc knuckle of the HIVNCp7 Deposited 2010-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 411–429（19 aa）	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 5.7；298 K；Ionic strength (raw mmCIF value) 6；Pressure ambient NMR sample composition 1 mM C-terminal zinc knuckle of the HIVNCp7, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2L45 C-terminal zinc knuckle of the HIVNCp7 with DNA Deposited 2010-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 411–429（19 aa）	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 5.7；298 K；Ionic strength (raw mmCIF value) 6.0；Pressure ambient NMR sample composition 1 mM C-terminal zinc knuckle of the HIVNCp7, 1 mM DNA, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2L46 C-terminal zinc finger of the HIVNCp7 with platinated DNA Deposited 2010-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 411–429（19 aa）	Not recorded	ZN ZINC ION × 1	SOLUTION NMR NMR measurement conditions pH 5.7；298 K；Ionic strength (raw mmCIF value) 6.0；Pressure ambient NMR sample composition 1 mM C-terminal zinc knuckle of the HIVNCp7, 1 mM DNA, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3OUA MDR769 HIV-1 protease complexed with p1/p6 hepta-peptide Deposited 2010-09-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 446–452（7 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；298 K；0.8M NaCl 01 M MES , pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.226
3OUC MDR769 HIV-1 protease complexed with p2/NC hepta-peptide Deposited 2010-09-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 375–381（7 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；298 K；0.8M NaCl 0.1 M MES , pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.262
3P9G Crystal structure of the TSG101 UEV domain in complex with FA459 peptide Deposited 2010-10-17	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 453–461（9 aa） Fragment：Modified HIV-1 Gag PTAP Motif	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1M HEPES-NAOH (PH7.5), 25% PEG 3350, 0.2M SODIUM NITRATE, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.242
4EP3 Crystal Structure of inactive single chain wild-type HIV-1 Protease in Complex with the substrate CA-p2 Deposited 2012-04-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 359–367（9 aa）	Not recorded	GOL GLYCEROL × 3 BME BETA-MERCAPTOETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；295 K；126mM Phosphate buffer pH 6.2, 63mM Sodium Citrate, 24-29% Ammonium Sulfate, hanging drop, vapor diffusion, temperature 295K, VAPOR DIFFUSION, HANGING DROP	Resolution 1.81 Å R-free 0.227
4EPJ Crystal Structure of inactive single chain wild-type HIV-1 Protease in Complex with the substrate p2-NC Deposited 2012-04-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 374–381（8 aa）	Not recorded	GOL GLYCEROL × 2 EDO 1,2-ETHANEDIOL × 1 DMS DIMETHYL SULFOXIDE × 1 ACT ACETATE ION × 1 BME BETA-MERCAPTOETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；295 K；126mM Phosphate buffer pH 6.2, 63mM Sodium Citrate, 24-29% Ammonium Sulfate, hanging drop, vapor diffusion, temperature 295K, VAPOR DIFFUSION, HANGING DROP	Resolution 1.69 Å R-free 0.227
4EQ0 Crystal Structure of inactive single chain variant of HIV-1 Protease in Complex with the substrate p2-NC Deposited 2012-04-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain P 374–381（8 aa）	Not recorded	BME BETA-MERCAPTOETHANOL × 1 EDO 1,2-ETHANEDIOL × 3 GOL GLYCEROL × 3 ACT ACETATE ION × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；295 K；126mM Phosphate buffer pH 6.2, 63mM Sodium Citrate, 24-29% Ammonium Sulfate, hanging drop, vapor diffusion, temperature 295K, VAPOR DIFFUSION, HANGING DROP	Resolution 1.70 Å R-free 0.264
4FAE Substrate p2/NC in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant Deposited 2012-05-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 375–381（7 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；298 K；0.1 M citric acid, 2.4 M ammonium sulfate, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.279

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9YP46_9HIV1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–10； UniProt 453–461

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3p9h
Deposition date deposition_date	2010-10-17
Structure title title	Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
Keywords keywords	PROTEIN TRANSPORT, Ubiquitin; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	16.85 Å
Radius of gyration Rg (electron density) rg_electron	15.37 Å
Forward intensity I(0) i0	5196930.00
Molecular weight molecular_weight	17254.0 kDa
Excluded volume excluded_volume	22004 Å³
Envelope volume envelope_volume	24958 Å³
Hydration-shell volume shell_volume	13792 Å³
Envelope diameter envelope_diameter	53.1 Å
Shell Rg shell_rg	21.08 Å
Envelope Rg envelope_rg	15.77 Å
Shape Rg shape_rg	15.36 Å
Total Rg total_rg	16.54 Å
Total atoms total_atoms	1216
Residues n_residues	149
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	53.9 Å
Rg (real space) rg_real	16.78 Å
Rg uncertainty (real space) rg_real_error	0.37 Å
I(0) (real space) i0_real	5.1970e+06
I(0) uncertainty (real space) i0_real_error	5.4470e+04
Rg (reciprocal space) rg_reciprocal	16.79 Å
I(0) (reciprocal space) i0_reciprocal	5197000.0000
Solution quality estimate total_estimate	0.8159
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	20.6 Å
Skewness Skewness skewness	0.225
Kurtosis Kurtosis kurtosis	-0.350
Angular range angular_range	— – 0.4700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1183000.0000
Real-space data points n_real_points	77
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.868; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tumor susceptibility gene 101 protein
Molecular weight formula_weight	16400.1 kDa
Mutation mutation	Mutation of 43VFNDGS48 to GG
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1339

GAMGSAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGGSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Gag polyprotein
Molecular weight formula_weight	1169.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

XPEXTAPPEEX

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	123

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3p9ha1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.20 — UBC-like
Superfamily Superfamily superfamily	d.20.1 — UBC-like
Family Family family	d.20.1.2 — UEV domain

Domain ID domain_id	d3p9ha2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	3p9hA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	110 — Ubiquitin Conjugating Enzyme
Homologous superfamily homologous superfamily	10 — Ubiquitin Conjugating Enzyme

▶

8. Citations (1)

▶

Unit-cell length a length_a	33.697 Å
Unit-cell length b length_b	45.797 Å
Unit-cell length c length_c	85.387 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	20.180 Å
R factor r_factor	0.2110
R_work r_work	0.2110
R_free r_free	0.2530

fit	/app/data/saxs_computation/p9/3p9h/3p9h.fit
pddf	/app/data/pr_computation/p9/3p9h/3p9h.pr.out
profile	/app/data/saxs_computation/p9/3p9h/3p9h.dat

Crystal structure of the TSG101 UEV domain in complex with FA258 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor susceptibility gene 101 protein

State in the Current Structure

Other States of the Same Protein in the Database

Gag polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)