4aym

Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 P106A mutant

Method: X-RAY DIFFRACTION D_max: 131.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMPLEMENT FACTOR H

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 321–443	Fragment：CCPS 6 AND 7, RESIDUES 321-443	FACTOR H BINDING PROTEIN × 1 （Q19KF7）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6；0.2 M IMIDAZOLE PH 6, 20% PEG 4000	Resolution 3.00 Å R-free 0.257
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 321–443	Fragment：CCPS 6 AND 7, RESIDUES 321-443	FACTOR H BINDING PROTEIN × 1 （Q19KF7）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6；0.2 M IMIDAZOLE PH 6, 20% PEG 4000	Resolution 3.00 Å R-free 0.257
3	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain E； UniProt 321–443	Fragment：CCPS 6 AND 7, RESIDUES 321-443	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6；0.2 M IMIDAZOLE PH 6, 20% PEG 4000	Resolution 3.00 Å R-free 0.257
4	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain F； UniProt 321–443	Fragment：CCPS 6 AND 7, RESIDUES 321-443	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6；0.2 M IMIDAZOLE PH 6, 20% PEG 4000	Resolution 3.00 Å R-free 0.257

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4AYM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HAQ FOUR MODELS OF HUMAN FACTOR H DETERMINED BY SOLUTION SCATTERING CURVE-FITTING AND HOMOLOGY MODELLING Deposited 2001-04-06	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–1231（1213 aa）	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING mmCIF provides none of the parsed conditions	Resolution not provided
1HCC THREE-DIMENSIONAL STRUCTURE OF A COMPLEMENT CONTROL PROTEIN MODULE IN SOLUTION Deposited 1990-11-28	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 927–985（59 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1HFH SOLUTION STRUCTURE OF A PAIR OF COMPLEMENT MODULES BY NUCLEAR MAGNETIC RESONANCE Deposited 1993-02-23	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 866–985（120 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1HFI SOLUTION STRUCTURE OF A PAIR OF COMPLEMENT MODULES BY NUCLEAR MAGNETIC RESONANCE Deposited 1993-02-23	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 866–927（62 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
2BZM Solution structure of the primary host recognition region of complement factor H Deposited 2005-08-18	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1107–1231（125 aa） Fragment：CCPS 19-20, RESIDUES 1107-1231	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4；310 K；Ionic strength (raw mmCIF value) 200；Pressure 1.0 NMR sample composition 10% WATER/90% D2O	Resolution not provided
2G7I Structure of Human Complement Factor H Carboxyl Terminal Domains 19-20: a Basis for Atypical Hemolytic Uremic Syndrome Deposited 2006-02-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1107–1231（125 aa） Fragment：C-terminal Domains 19-20	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；Before crystallization the protein was concentrated to 10 mg/ml and dialysed into 20 mM Tris, 50 mM NaCl, pH 7.0. The protein was crystallized in sitting drops by mixing 1 ul of protein solution at 10 mg/ml with 1 ul of reservoir solution of 2.2 M (NH4)2SO4, 0.1 M Tris-HCl, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 1.75 Å R-free 0.225
2IC4 Solution structure of the His402 allotype of the Factor H SCR6-SCR7-SCR8 fragment Deposited 2006-09-12	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 321–506（186 aa） Fragment：Factor H SCR6-SCR7-SCR8	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING X-ray crystallization conditions pH 7.3；288 K；SOLUTION, pH 7.3, temperature 288K	Resolution not provided
2JGW Structure of CCP module 7 of complement factor H - The AMD at risk varient (402H) Deposited 2007-02-16	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 386–446（61 aa） Fragment：CCP MODULE 7, RESIDUES 386-446	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.2；298 K；Ionic strength (raw mmCIF value) 20；Pressure 1.0 NMR measurement conditions pH 5.2；298 K；Ionic strength (raw mmCIF value) 20；Pressure 1.0 NMR sample composition 10% WATER/90% D2O	Resolution not provided
2JGX Structure of CCP module 7 of complement factor H - The AMD Not at risk varient (402Y) Deposited 2007-02-16	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 386–446（61 aa） Fragment：CCP MODULE 7, RESIDUES 386-446	Mutation：YES	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.2；298 K；Ionic strength (raw mmCIF value) 20；Pressure 1.0 NMR measurement conditions pH 5.2；298 K；Ionic strength (raw mmCIF value) 20；Pressure 1.0 NMR sample composition 10% WATER/90% D2O	Resolution not provided
2KMS Combined high- and low-resolution techniques reveal compact structure in central portion of factor H despite long inter-modular linkers Deposited 2009-08-04	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 690–804（115 aa） Fragment：Sushi domain, residues 690-804	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.6；298 K；Ionic strength (raw mmCIF value) 20；Pressure ambient NMR sample composition 20mM potassium phosphate-1, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2QFG Solution Structure of the N-terminal SCR-1/5 fragment of Complement Factor H. Deposited 2007-06-27	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–322（304 aa） Fragment：SCR domains 1-5 (residues 19-322)	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING mmCIF provides none of the parsed conditions	Resolution not provided
2QFH Solution Structure of the C-terminal SCR-16/20 fragment of Complement Factor H. Deposited 2007-06-27	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 928–1231（304 aa） Fragment：SCR domains 16-20 (residues 928-1231)	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING mmCIF provides none of the parsed conditions	Resolution not provided
2RLP NMR structure of CCP modules 1-2 of complement factor H Deposited 2007-07-28	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–142（123 aa） Fragment：residues in database 20-142	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.2；310 K；Pressure ambient NMR sample composition 1mM [U-95% 13C; U-95% 15N] FactorH CCP1-2, 10mM potassium phosphate, 12mg/mL Pf1 phage, 50mM L-Arg, 50mM L-Glu, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM FactorH CCP1-2, 10mM potassium phosphate, 50mM L-Arg, 50mM L-Glu, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM FactorH CCP1-2, 10mM potassium phosphate, 50mM L-Arg, 50mM L-Glu, 100% D2O \| 100% D2O	Resolution not provided
2RLQ NMR structure of CCP modules 2-3 of complement factor H Deposited 2007-07-29	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 84–206（123 aa） Fragment：residues in database 84-206	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.2；310 K；Pressure ambient NMR sample composition 2mM [U-95% 13C; U-95% 15N] FactorH CCP2-3, 10mM potassium phosphate, 12mg/mL Pf1 phage, 50mM L-Arg, 50mM L-Glu, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 3mM FactorH CCP2-3, 10mM potassium phosphate, 50mM L-Arg, 50mM L-Glu, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM FactorH CCP2-3, 10mM potassium phosphate, 50mM L-Arg, 50mM L-Glu, 100% D2O \| 100% D2O	Resolution not provided
2UWN Crystal structure of Human Complement Factor H, SCR domains 6-8 (H402 risk variant), in complex with ligand. Deposited 2007-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 322–506（185 aa） Fragment：DOMAINS 6,7 AND 8, RESIDUES 322-506	Not recorded	ACT ACETATE ION × 1 CL CHLORIDE ION × 2 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；0.1M SODIUM ACETATE, PH4.5, 20% (W/V) PEG3000	Resolution 2.35 Å R-free 0.246
2V8E Crystal structure of Human Complement Factor H, SCR domains 6-8 (H402 risk variant), in complex with ligand. Deposited 2007-08-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 322–506（185 aa） Fragment：DOMAINS 6,7 AND 8, RESIDUES 322-506	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2 SO4 SULFATE ION × 3 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；0.1M SODIUM ACETATE, PH4.5, 20% (W/V) PEG3000	Resolution 2.50 Å R-free 0.245
2W80 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH9.0	Resolution 2.35 Å R-free 0.263
2W80 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH9.0	Resolution 2.35 Å R-free 0.263
2W80 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH9.0	Resolution 2.35 Å R-free 0.263
2W80 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH9.0	Resolution 2.35 Å R-free 0.263
2W81 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.35 Å R-free 0.283
2W81 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.35 Å R-free 0.283
2W81 Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs 6-7 of human complement factor H Deposited 2009-01-08	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.35 Å R-free 0.283
2WII Complement C3b in complex with factor H domains 1-4 Deposited 2009-05-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 18–264（247 aa） Fragment：RESIDUES 18-264	Not recorded	CA CALCIUM ION × 1 GOL GLYCEROL × 17 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；7.0% (W/V) PEG 3,350, 70 MM AMMONIUM ACETATE, PH 7.1	Resolution 2.70 Å R-free 0.252
2WII Complement C3b in complex with factor H domains 1-4 Deposited 2009-05-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 18–264（247 aa） Fragment：RESIDUES 18-264	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；7.0% (W/V) PEG 3,350, 70 MM AMMONIUM ACETATE, PH 7.1	Resolution 2.70 Å R-free 0.252
2XQW Structure of Factor H domains 19-20 in complex with complement C3d Deposited 2010-09-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1103–1231（129 aa） Fragment：DOMAINS 19-20, RESIDUES 1103-1231	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；295 K；12-18% PEG 4000, 0.1 M HEPES, PH 7.5, AT 22 DEGREES C	Resolution 2.31 Å R-free 0.242
2XQW Structure of Factor H domains 19-20 in complex with complement C3d Deposited 2010-09-07	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1103–1231（129 aa） Fragment：DOMAINS 19-20, RESIDUES 1103-1231	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；295 K；12-18% PEG 4000, 0.1 M HEPES, PH 7.5, AT 22 DEGREES C	Resolution 2.31 Å R-free 0.242
3GAU Solution structure of Human Complement Factor H in 50 mM NaCl buffer Deposited 2009-02-18	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–1231（1213 aa）	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING mmCIF provides none of the parsed conditions	Resolution not provided
3GAV Solution structure of Human Complement Factor H in 137 mM NaCl buffer Deposited 2009-02-18	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–1231（1213 aa）	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING mmCIF provides none of the parsed conditions	Resolution not provided
3GAW Solution structure of Human Complement Factor H in 250 mM NaCl buffer Deposited 2009-02-18	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–1231（1213 aa）	Not recorded	No recorded non-water small molecule	SOLUTION SCATTERING mmCIF provides none of the parsed conditions	Resolution not provided
3KXV Structure of complement Factor H variant Q1139A Deposited 2009-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1103–1231（129 aa） Fragment：Sushi domains 19-20	Mutation：Q1139A	SO4 SULFATE ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；295.15 K；2M ammonium sulphate, 0.1M Bis-Tris buffer, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.15K	Resolution 2.00 Å R-free 0.244
3KZJ Structure of complement Factor H variant R1203A Deposited 2009-12-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1103–1231（129 aa） Fragment：Sushi domains 19-20	Mutation：R1203A	SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295.15 K；2M Ammonium Sulphate, 0.1M Bis-Tris buffer, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.15K	Resolution 1.65 Å R-free 0.222
3R62 Structure of complement regulator Factor H mutant, T1184R. Deposited 2011-03-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1107–1231（125 aa） Fragment：Complement Factor H modules 19 and 20	Mutation：T1184R	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；290 K；0.1M Tris HCl, pH 8.5 and 12% polyethylene glycol 8000 , VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 1.52 Å R-free 0.208
3R62 Structure of complement regulator Factor H mutant, T1184R. Deposited 2011-03-21	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1107–1231（125 aa） Fragment：Complement Factor H modules 19 and 20	Mutation：T1184R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；290 K；0.1M Tris HCl, pH 8.5 and 12% polyethylene glycol 8000 , VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 1.52 Å R-free 0.208
3SW0 Structure of the C-terminal region (modules 18-20) of complement regulator Factor H Deposited 2011-07-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 1046–1231（186 aa） Fragment：unp residues 1046-1231	Not recorded	GOL GLYCEROL × 4 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；290 K；0.1M Sodium Acetate trihydrate, pH 4.6, 2% v/v Tacsimate, pH 4.0 (Hampton Research formulation containing: 1.8305 M Malonic acid, 0.25 M Ammonium citrate tribasic, 0.12 M Succinic acid, 0.3 M DL-Malic acid, 0.4 M Sodium acetate trihydrate, 0.5 M Sodium formate, 0.16 M Ammonium tartrate dibasic and pH adjusted using NaOH) and 16% w/v polyethylene glycol 3350 as the precipitant, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 1.80 Å R-free 0.226
4AYD Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 R106A mutant Deposited 2012-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.40 Å R-free 0.231
4AYD Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 R106A mutant Deposited 2012-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.40 Å R-free 0.231
4AYD Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 R106A mutant Deposited 2012-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.40 Å R-free 0.231
4AYE Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 E283AE304A mutant Deposited 2012-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.80 Å R-free 0.226
4AYE Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 E283AE304A mutant Deposited 2012-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.80 Å R-free 0.226
4AYE Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 1 E283AE304A mutant Deposited 2012-06-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；20% PEG 6000, 0.1M BICINE PH 9.0	Resolution 2.80 Å R-free 0.226
4AYI Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 Wild type Deposited 2012-06-21	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；0.2 M IMIDAZOLE PH 6 20% PEG 4000	Resolution 2.31 Å R-free 0.252
4AYI Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 Wild type Deposited 2012-06-21	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 321–443（123 aa） Fragment：CCPS 6 AND 7, RESIDUES 321-443	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；0.2 M IMIDAZOLE PH 6 20% PEG 4000	Resolution 2.31 Å R-free 0.252
4B2R Solution structure of CCP modules 10-11 of complement factor H Deposited 2012-07-17	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 566–687（122 aa） Fragment：CCPS 10-11, RESIDUES 566-687	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.7；298 K；Ionic strength (raw mmCIF value) 0.02；Pressure 1.0 NMR measurement conditions pH 6.7；298 K；Ionic strength (raw mmCIF value) 0.02；Pressure 1.0 NMR measurement conditions pH 6.7；298 K；Ionic strength (raw mmCIF value) 0.02；Pressure 1.0 NMR measurement conditions pH 6.7；298 K；Ionic strength (raw mmCIF value) 0.02；Pressure 1.0 NMR sample composition 90% H2O/10% D2O NMR sample composition 90% H2O/10% D2O 90% H2O/10% D2O NMR sample composition 90% H2O/10% D2O	Resolution not provided
4B2S Solution structure of CCP modules 11-12 of complement factor H Deposited 2012-07-17	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 627–747（121 aa） Fragment：CCPS 11-12, RESIDUES 627-747	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；298 K；Ionic strength (raw mmCIF value) 0.02；Pressure 1.0 NMR measurement conditions pH 6.3；298 K；Ionic strength (raw mmCIF value) 0.02；Pressure 1.0 NMR sample composition 90% H2O/10% D2O	Resolution not provided
4J38 Structure of Borrelia burgdorferi Outer surface protein E in complex with Factor H domains 19-20 Deposited 2013-02-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1103–1231（129 aa） Fragment：FH domains 19-20, UNP residues 1103-1231	Mutation：D1119G, Q1139A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；2M Ammonium sulfate, 0.1M Citric acid, 0.2M Sodium chloride, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.83 Å R-free 0.255
4K12 Structural Basis for Host Specificity of Factor H Binding by Streptococcus pneumoniae Deposited 2013-04-04	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 508–567（60 aa） Fragment：sushi domain (UNP residues 508-567)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；20% PEG3500, 0.1 M sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；20% PEG3500, 0.1 M sodium acetate, soaked in 0.5 M sodium iodide, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.08 Å R-free 0.170
4ONT Ternary host recognition complex of complement factor H, C3d, and sialic acid Deposited 2014-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1107–1231（125 aa） Fragment：Sushi 19-20 domains (UNP residues 1107-1231)	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1 M Tris-HCl, pH 9.0, 8% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.15 Å R-free 0.223
4ONT Ternary host recognition complex of complement factor H, C3d, and sialic acid Deposited 2014-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1107–1231（125 aa） Fragment：Sushi 19-20 domains (UNP residues 1107-1231)	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1 M Tris-HCl, pH 9.0, 8% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.15 Å R-free 0.223
4ONT Ternary host recognition complex of complement factor H, C3d, and sialic acid Deposited 2014-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1107–1231（125 aa） Fragment：Sushi 19-20 domains (UNP residues 1107-1231)	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1 M Tris-HCl, pH 9.0, 8% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.15 Å R-free 0.223
4ZH1 Complement factor H in complex with the GM1 glycan Deposited 2015-04-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1107–1231（125 aa） Fragment：residues 1107-1231	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M TRIS-HCL, PH 9.0, 8% W/V PRG 8000	Resolution 2.24 Å R-free 0.228
4ZH1 Complement factor H in complex with the GM1 glycan Deposited 2015-04-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1107–1231（125 aa） Fragment：residues 1107-1231	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M TRIS-HCL, PH 9.0, 8% W/V PRG 8000	Resolution 2.24 Å R-free 0.228
4ZH1 Complement factor H in complex with the GM1 glycan Deposited 2015-04-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1107–1231（125 aa） Fragment：residues 1107-1231	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M TRIS-HCL, PH 9.0, 8% W/V PRG 8000	Resolution 2.24 Å R-free 0.228
5NBQ The structure of the tripartite complex between OspE, the C-terminal domains of factor H and C3dg Deposited 2017-03-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1104–1230（127 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；20% PEG3350, 0.1 M HEPES pH 7.5, 0.2 M MgCl2 or 24% PEG3350, 0.1 M HEPES pH 7.5, 0.2 M MgCl2 or 16% PEG3350, Tris pH 8.5, 0.2 M ammonium acetate	Resolution 3.18 Å R-free 0.261
5NBQ The structure of the tripartite complex between OspE, the C-terminal domains of factor H and C3dg Deposited 2017-03-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1104–1230（127 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；20% PEG3350, 0.1 M HEPES pH 7.5, 0.2 M MgCl2 or 24% PEG3350, 0.1 M HEPES pH 7.5, 0.2 M MgCl2 or 16% PEG3350, Tris pH 8.5, 0.2 M ammonium acetate	Resolution 3.18 Å R-free 0.261
5NBQ The structure of the tripartite complex between OspE, the C-terminal domains of factor H and C3dg Deposited 2017-03-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1104–1230（127 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；20% PEG3350, 0.1 M HEPES pH 7.5, 0.2 M MgCl2 or 24% PEG3350, 0.1 M HEPES pH 7.5, 0.2 M MgCl2 or 16% PEG3350, Tris pH 8.5, 0.2 M ammonium acetate	Resolution 3.18 Å R-free 0.261
5O32 The structure of complement complex Deposited 2017-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain C 19–264（246 aa） Fragment：UNP residues 19-264,UNP residues 1107-1230,UNP residues 19-264,UNP residues 1107-1230 Chain C 1107–1230（124 aa） Fragment：UNP residues 19-264,UNP residues 1107-1230,UNP residues 19-264,UNP residues 1107-1230 Chain G 19–264（246 aa） Fragment：UNP residues 19-264,UNP residues 1107-1230,UNP residues 19-264,UNP residues 1107-1230 Chain G 1107–1230（124 aa） Fragment：UNP residues 19-264,UNP residues 1107-1230,UNP residues 19-264,UNP residues 1107-1230	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 MLI MALONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；60mM sodium malonate PH5.0 6% w/v PEG3350	Resolution 4.21 Å R-free 0.254
5O35 Structure of complement proteins complex Deposited 2017-05-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 19–264（246 aa） Chain C 1107–1231（125 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.15 K；60mM Ammonium sulfate, 6% w/v PEG3350	Resolution 4.20 Å R-free 0.246
5WTB Complex Structure of Staphylococcus aureus SdrE with human complement factor H Deposited 2016-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1206–1226（21 aa） Fragment：UNP residues 1206-1226	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M HEPES sodium pH 7.5, 0.2M Magnesium chloride, 30% PEG 400 (v/v)	Resolution 3.30 Å R-free 0.281
5WTB Complex Structure of Staphylococcus aureus SdrE with human complement factor H Deposited 2016-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1206–1226（21 aa） Fragment：UNP residues 1206-1226	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M HEPES sodium pH 7.5, 0.2M Magnesium chloride, 30% PEG 400 (v/v)	Resolution 3.30 Å R-free 0.281
5WTB Complex Structure of Staphylococcus aureus SdrE with human complement factor H Deposited 2016-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1206–1226（21 aa） Fragment：UNP residues 1206-1226	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M HEPES sodium pH 7.5, 0.2M Magnesium chloride, 30% PEG 400 (v/v)	Resolution 3.30 Å R-free 0.281
5WTB Complex Structure of Staphylococcus aureus SdrE with human complement factor H Deposited 2016-12-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1206–1226（21 aa） Fragment：UNP residues 1206-1226	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M HEPES sodium pH 7.5, 0.2M Magnesium chloride, 30% PEG 400 (v/v)	Resolution 3.30 Å R-free 0.281
6ZH1 Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii Deposited 2020-06-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1104–1231（128 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.7；293.15 K；0.1 M MES pH6.7, 0.2 M Ammonium Sulfate, 20% (v/v) PEG 4000	Resolution 2.20 Å R-free 0.240
7WKI Structure of the ultra-affinity complex between CFH and a nanobody Deposited 2022-01-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1046–1231（186 aa） Fragment：C-terminal domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Sodium Phosphate monohydrate, 20% PEG 3350	Resolution 2.60 Å R-free 0.239
7ZJM Crystal structure of a complex between CspZ from Borrelia burgdorferi strain B408 and human FH SCR domains 6-7 Deposited 2022-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–444（124 aa）	Not recorded	ZN ZINC ION × 7 IMD IMIDAZOLE × 4 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；294 K；0.2 M Zinc acetate 0.1 M imidazole (pH 7.4) 10% PEG 3000	Resolution 2.59 Å R-free 0.276
9F7I Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7 Deposited 2024-05-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–444（124 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；294 K；0.25 M ammonium sulfate 0.1 M MES pH 6.5 10% PEG 3000	Resolution 2.85 Å R-free 0.261
9MLU FbaA with Factor H 6-7 domain Deposited 2024-12-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 321–443（123 aa）	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；MES pH 6.0, Sodium chloride, PEG 6000, Ethylene Glycol	Resolution 1.82 Å R-free 0.276
9MLU FbaA with Factor H 6-7 domain Deposited 2024-12-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 321–443（123 aa）	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；MES pH 6.0, Sodium chloride, PEG 6000, Ethylene Glycol	Resolution 1.82 Å R-free 0.276
9MMU M5 protein with Factor H 6-7 domain Deposited 2024-12-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 321–443（123 aa） Chain D 321–443（123 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；PEG 6000, Ethylene glycol, Sodium Chloride	Resolution 2.25 Å R-free 0.287
9MMU M5 protein with Factor H 6-7 domain Deposited 2024-12-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 321–443（123 aa） Chain H 321–443（123 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；PEG 6000, Ethylene glycol, Sodium Chloride	Resolution 2.25 Å R-free 0.287
9MMX M6 protein with Factor H 6-7 domain Deposited 2024-12-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 321–443（123 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；PEG 6000, ethylene glycol, Sodium chloride	Resolution 1.90 Å R-free 0.302
9MMX M6 protein with Factor H 6-7 domain Deposited 2024-12-20	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 321–443（123 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；PEG 6000, ethylene glycol, Sodium chloride	Resolution 1.90 Å R-free 0.302

47 other PDB entries and 72 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CFAH_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–125； UniProt 321–443 Author chain B； PDBConstruct 3–125； UniProt 321–443 Author chain E； PDBConstruct 3–125； UniProt 321–443 Author chain F； PDBConstruct 3–125； UniProt 321–443

FACTOR H BINDING PROTEIN

NEISSERIA MENINGITIDIS MC58

UniProt Q19KF7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 32–281	Fragment：RESIDUES 32-281 Mutation：YES	COMPLEMENT FACTOR H × 1 （P08603）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6；0.2 M IMIDAZOLE PH 6, 20% PEG 4000	Resolution 3.00 Å R-free 0.257
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 32–281	Fragment：RESIDUES 32-281 Mutation：YES	COMPLEMENT FACTOR H × 1 （P08603）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6；0.2 M IMIDAZOLE PH 6, 20% PEG 4000	Resolution 3.00 Å R-free 0.257

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4AYM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4AYI Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 Wild type Deposited 2012-06-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 32–281（250 aa） Fragment：RESIDUES 32-281	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；0.2 M IMIDAZOLE PH 6 20% PEG 4000	Resolution 2.31 Å R-free 0.252
6H2Y human Fab 1E6 bound to fHbp variant 3 from Neisseria meningitidis serogroup B Deposited 2018-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 32–281（250 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 12 PEG DI(HYDROXYETHYL)ETHER × 1 P33 3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；Molecular Dimensions Morpheus HT-96 screen, well D9	Resolution 2.65 Å R-free 0.275

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q19KF7_NEIME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 13–262； UniProt 32–281 Author chain D； PDBConstruct 13–262； UniProt 32–281

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4aym
Deposition date deposition_date	2012-06-21
Structure title title	Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 P106A mutant
Keywords keywords	IMMUNE SYSTEM, ANTIGENS, VACCINES; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	37.75 Å
Radius of gyration Rg (electron density) rg_electron	37.64 Å
Forward intensity I(0) i0	182703000.00
Molecular weight molecular_weight	106360.0 kDa
Excluded volume excluded_volume	131820 Å³
Envelope volume envelope_volume	188340 Å³
Hydration-shell volume shell_volume	43476 Å³
Envelope diameter envelope_diameter	139.0 Å
Shell Rg shell_rg	41.76 Å
Envelope Rg envelope_rg	37.29 Å
Shape Rg shape_rg	37.63 Å
Total Rg total_rg	37.98 Å
Total atoms total_atoms	7500
Residues n_residues	946
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	131.2 Å
Rg (real space) rg_real	37.96 Å
Rg uncertainty (real space) rg_real_error	1.17 Å
I(0) (real space) i0_real	1.8270e+08
I(0) uncertainty (real space) i0_real_error	3.0300e+06
Rg (reciprocal space) rg_reciprocal	37.83 Å
I(0) (reciprocal space) i0_reciprocal	182700000.0000
Solution quality estimate total_estimate	0.8660
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	40.6 Å
Skewness Skewness skewness	0.440
Kurtosis Kurtosis kurtosis	-0.363
Angular range angular_range	— – 0.2100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	14430000.0000
Real-space data points n_real_points	43
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.793; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.944; Smooth: 0.932

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	COMPLEMENT FACTOR H
Molecular weight formula_weight	14410.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F
Atom count atom_count	7506

MGTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCI

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	FACTOR H BINDING PROTEIN
Molecular weight formula_weight	29487.8 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MGPDSDRLQQRRVAADIGTGLADALTAPLDHKDKGLKSLTLEDSIAQNGTLTLSAQGAEKTFKAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQLEHHHHHH

来源 Source

来源生物 organism	NEISSERIA MENINGITIDIS MC58
NCBI Class编号 ncbi_taxonomy_id	122586
宿主生物 host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	6

▼

7. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	4aymA01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymA02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymB01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymB02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1980 —

Domain ID domain_id	4aymC02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	4aymD01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1980 —

Domain ID domain_id	4aymD02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	4aymE01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymE02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymF01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	4aymF02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

▶

8. Citations (1)

▶

Unit-cell length a length_a	78.090 Å
Unit-cell length b length_b	83.490 Å
Unit-cell length c length_c	361.430 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2545
R_work r_work	0.2543
R_free r_free	0.2567

fit	/app/data/saxs_computation/ay/4aym/4aym.fit
pddf	/app/data/pr_computation/ay/4aym/4aym.pr.out
profile	/app/data/saxs_computation/ay/4aym/4aym.dat

Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria meningitidis FHbp Variant 3 P106A mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMPLEMENT FACTOR H

State in the Current Structure

Other States of the Same Protein in the Database

FACTOR H BINDING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)