SAXSdb — 4bog

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetylcholine receptor beta subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Acetylcholine receptor delta subunit × 6 （Q6S3H8） Acetylcholine receptor subunit alpha × 12 （P02711） Acetylcholine receptor gamma subunit × 6 （Q6S3H9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6S3I0_TORMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–493； UniProt 1–493 Author chain B； PDBConstruct 1–493； UniProt 1–493 Author chain G； PDBConstruct 1–493； UniProt 1–493 Author chain L； PDBConstruct 1–493； UniProt 1–493 Author chain Q； PDBConstruct 1–493； UniProt 1–493 Author chain V； PDBConstruct 1–493； UniProt 1–493

Acetylcholine receptor delta subunit

OrganismNot specified

UniProt Q6S3H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Acetylcholine receptor beta subunit × 6 （Q6S3I0） Acetylcholine receptor subunit alpha × 12 （P02711） Acetylcholine receptor gamma subunit × 6 （Q6S3H9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6S3H8_TORMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–522； UniProt 1–522 Author chain C； PDBConstruct 1–522； UniProt 1–522 Author chain H； PDBConstruct 1–522； UniProt 1–522 Author chain M； PDBConstruct 1–522； UniProt 1–522 Author chain R； PDBConstruct 1–522； UniProt 1–522 Author chain W； PDBConstruct 1–522； UniProt 1–522

Acetylcholine receptor subunit alpha

OrganismNot specified

UniProt P02711

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Acetylcholine receptor beta subunit × 6 （Q6S3I0） Acetylcholine receptor delta subunit × 6 （Q6S3H8） Acetylcholine receptor gamma subunit × 6 （Q6S3H9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACHA_TORMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–461； UniProt 1–461 Author chain A； PDBConstruct 1–461； UniProt 1–461 Author chain D； PDBConstruct 1–461； UniProt 1–461 Author chain F； PDBConstruct 1–461； UniProt 1–461 Author chain I； PDBConstruct 1–461； UniProt 1–461 Author chain K； PDBConstruct 1–461； UniProt 1–461 Author chain N； PDBConstruct 1–461； UniProt 1–461 Author chain P； PDBConstruct 1–461； UniProt 1–461 Author chain S； PDBConstruct 1–461； UniProt 1–461 Author chain U； PDBConstruct 1–461； UniProt 1–461 Author chain X； PDBConstruct 1–461； UniProt 1–461 Author chain Z； PDBConstruct 1–461； UniProt 1–461

Acetylcholine receptor gamma subunit

OrganismNot specified

UniProt Q6S3H9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Acetylcholine receptor beta subunit × 6 （Q6S3I0） Acetylcholine receptor delta subunit × 6 （Q6S3H8） Acetylcholine receptor subunit alpha × 12 （P02711）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6S3H9_TORMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–505； UniProt 1–505 Author chain E； PDBConstruct 1–505； UniProt 1–505 Author chain J； PDBConstruct 1–505； UniProt 1–505 Author chain O； PDBConstruct 1–505； UniProt 1–505 Author chain T； PDBConstruct 1–505； UniProt 1–505 Author chain Y； PDBConstruct 1–505； UniProt 1–505

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4bog
Deposition date deposition_date	2013-05-20
Structure title title	The structure and super-organization of acetylcholine receptor-rapsyn complexes
Keywords keywords	TRANSPORT PROTEIN, CLUSTERING, SYNAPSE, NEUROMUSCULAR JUNCTION, NICOTINIC, RAPSYN, 43K, ELECTRIC ORGAN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4bog__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4bog__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4bog__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	100.40 Å
Total Rg	100.20 Å
Atom count	89544
Residues	11106
Excluded volume	1618800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4bog__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Acetylcholine receptor beta subunit
Molecular weight formula_weight	56123.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,B,G,L,Q,V
Atom count atom_count	89544

MEDVRRMALGLVVMMALALSGVGASVMEDTLLSVLFENYNPKVRPSQTVGDKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSIPSDDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVILQHALDAKGEREVKEIMINQDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIVPCILISILAILVFYLPPDAGEKMSLSISALLALTVFLLLLADKVPETSLSVPIIISYLMFIMILVAFSVILSVVVLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKPAGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASEFDDLKKDWQYVAMVADRLFLYIFITMCSIGTFSIFLDASHNVPPDNPFA

Entity 2 Entity 2 polymer

Description description	Acetylcholine receptor delta subunit
Molecular weight formula_weight	60017.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,C,H,M,R,W

MGNIHFVYLLISCLYYSGCSGVNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLMTDTIDGKDYPIEWIIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRVDEIEQPDWQNDLKLRRSSSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIKSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAKPFEGDPFDYSSDHPRCA

Entity 3 Entity 3 polymer

Description description	Acetylcholine receptor subunit alpha
Molecular weight formula_weight	52845.5 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,A,D,F,I,K,N,P,S,U,X,Z

MILCSYWHVGLVLLLFSCCGLVLGSEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLINVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIVTVVVINTHHRSPSTHTMPQWVRKIFINTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEVIFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG

Entity 4 Entity 4 polymer

Description description	Acetylcholine receptor gamma subunit
Molecular weight formula_weight	58118.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,E,J,O,T,Y

MVLTLLLIICLALEVRSNEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEVVEWIHIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSLSEKIKHLFLEFLPKYLGMHLEPSEETPEKPQPRRRSSFGIMIKAEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPEFPFPGDPRKYVP

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	50.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	50.00 Å
Resolution测定Method resolution_method	MAXIMUM LIKELIHOOD SUBTOMOGRAM AVERAGING
颗粒数 num_particles	3564

The structure and super-organization of acetylcholine receptor-rapsyn complexes

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetylcholine receptor beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Acetylcholine receptor delta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Acetylcholine receptor subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Acetylcholine receptor gamma subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4bog__assembly_1__model_1

4bog__assembly_1__model_1 | I(q)

4bog__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)

The structure and super-organization of acetylcholine receptor-rapsyn complexes

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetylcholine receptor beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acetylcholine receptor delta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acetylcholine receptor subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acetylcholine receptor gamma subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4bog__assembly_1__model_1

4bog__assembly_1__model_1 | I(q)

4bog__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)