SAXSdb — 4e2i

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large T antigen

Simian virus 40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	DNA polymerase alpha subunit B × 6 （Q14181） ZINC ION × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA polymerase alpha subunit B × 5 （Q14181） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9DH70_SV40
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–362； UniProt 266–627 Author chain B； PDBConstruct 1–362； UniProt 266–627 Author chain C； PDBConstruct 1–362； UniProt 266–627 Author chain D； PDBConstruct 1–362； UniProt 266–627 Author chain E； PDBConstruct 1–362； UniProt 266–627 Author chain F； PDBConstruct 1–362； UniProt 266–627 Author chain G； PDBConstruct 1–362； UniProt 266–627 Author chain H； PDBConstruct 1–362； UniProt 266–627 Author chain I； PDBConstruct 1–362； UniProt 266–627 Author chain J； PDBConstruct 1–362； UniProt 266–627 Author chain K； PDBConstruct 1–362； UniProt 266–627 Author chain L； PDBConstruct 1–362； UniProt 266–627

DNA polymerase alpha subunit B

Homo sapiens

UniProt Q14181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Large T antigen × 6 （Q9DH70） ZINC ION × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	Large T antigen × 6 （Q9DH70） ZINC ION × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DPOA2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–78； UniProt 1–78 Author chain 2； PDBConstruct 1–78； UniProt 1–78 Author chain 3； PDBConstruct 1–78； UniProt 1–78 Author chain 4； PDBConstruct 1–78； UniProt 1–78 Author chain 5； PDBConstruct 1–78； UniProt 1–78 Author chain 6； PDBConstruct 1–78； UniProt 1–78 Author chain 7； PDBConstruct 1–78； UniProt 1–78 Author chain 8； PDBConstruct 1–78； UniProt 1–78 Author chain 9； PDBConstruct 1–78； UniProt 1–78 Author chain U； PDBConstruct 1–78； UniProt 1–78 Author chain W； PDBConstruct 1–78； UniProt 1–78

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4e2i
Deposition date deposition_date	2012-03-08
Structure title title	The Complex Structure of the SV40 Helicase Large T Antigen and p68 Subunit of DNA Polymerase Alpha-Primase
Keywords keywords	replication initiation, Hydrolase-DNA binding complex, Hydrolase-DNA binding Protein complex; Hydrolase/DNA binding Protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4e2i__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4e2i__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4e2i__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.06 Å
Rg (electron density)	44.39 Å
Total Rg	44.77 Å
Atom count	21240
Residues	2640
Excluded volume	382750 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4e2i__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4e2i__assembly_2__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Large T antigen
Molecular weight formula_weight	41812.7 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	41874

KQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLD

Source Source

Source organism organism	Simian virus 40
Common name common_name	SV40
NCBI taxonomy ID ncbi_taxonomy_id	10633
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DNA polymerase alpha subunit B
Molecular weight formula_weight	8700.9 kDa
Source method src_method	man
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,3,6,U,W,5,7,9,1,4,8

MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFLSKRLSKAR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	249.098 Å
Unit-cell length b length_b	249.098 Å
Unit-cell length c length_c	387.032 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	96

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	5.000 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.3047
R_work r_work	0.3047
R_free r_free	0.3139

The Complex Structure of the SV40 Helicase Large T Antigen and p68 Subunit of DNA Polymerase Alpha-Primase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large T antigen

State in the Current Structure

Other States of the Same Protein in the Database

DNA polymerase alpha subunit B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4e2i__assembly_1__model_1

4e2i__assembly_1__model_1 | I(q)

4e2i__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

The Complex Structure of the SV40 Helicase Large T Antigen and p68 Subunit of DNA Polymerase Alpha-Primase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large T antigen

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA polymerase alpha subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4e2i__assembly_1__model_1

4e2i__assembly_1__model_1 | I(q)

4e2i__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)