4l6v

Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

Synechocystis sp. PCC 6803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AHT3_9SYNC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–751； UniProt 1–751 Author chain A； PDBConstruct 1–751； UniProt 1–751 Author chain a； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

Synechocystis sp. PCC 6803

UniProt L8AIC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AIC0_9SYNC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–731； UniProt 1–731 Author chain B； PDBConstruct 1–731； UniProt 1–731 Author chain b； PDBConstruct 1–731； UniProt 1–731

Photosystem I iron-sulfur center

Synechocystis sp. PCC 6803

UniProt L8AST2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AST2_9SYNC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–81； UniProt 1–81 Author chain C； PDBConstruct 1–81； UniProt 1–81 Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I subunit II

Synechocystis sp. PCC 6803

UniProt L8AFM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AFM8_9SYNC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–141； UniProt 1–141 Author chain D； PDBConstruct 1–141； UniProt 1–141 Author chain d； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

Synechocystis sp. PCC 6803

UniProt L8ASH8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8ASH8_9SYNC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 5； PDBConstruct 1–74； UniProt 1–74 Author chain E； PDBConstruct 1–74； UniProt 1–74 Author chain e； PDBConstruct 1–74； UniProt 1–74

Fusion protein of Photosystem I subunit III and subunit IX

Bacillus subtilis BEST7613

UniProt L8AII8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AII8_9SYNC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 6； PDBConstruct 44–125； UniProt 103–184 Author chain F； PDBConstruct 44–125； UniProt 103–184 Author chain f； PDBConstruct 44–125； UniProt 103–184

Fusion protein of Photosystem I subunit III and subunit IX

Bacillus subtilis BEST7613

UniProt Q55329

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 6； PDBConstruct 1–40； UniProt 1–40 Author chain F； PDBConstruct 1–40； UniProt 1–40 Author chain f； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit XI

Synechocystis sp. PCC 6803

UniProt L8APN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8APN7_9SYNC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 8； PDBConstruct 1–157； UniProt 1–157 Author chain L； PDBConstruct 1–157； UniProt 1–157 Author chain l； PDBConstruct 1–157； UniProt 1–157

Photosystem I reaction center subunit XII

Synechocystis sp. PCC 6803

UniProt L8ADF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I subunit III × 1 （L8AP84） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8ADF9_9SYNC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–31； UniProt 1–31 Author chain M； PDBConstruct 1–31； UniProt 1–31 Author chain m； PDBConstruct 1–31； UniProt 1–31

Photosystem I subunit III

Synechocystis sp. PCC 6803

UniProt L8AP84

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I reaction center subunit VIII × 1 （L8APJ0） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AP84_9SYNC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 9； PDBConstruct 1–40； UniProt 1–40 Author chain I； PDBConstruct 1–40； UniProt 1–40 Author chain i； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit VIII

Synechocystis sp. PCC 6803

UniProt L8APJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count
3	Insufficient information	Heteromer	Protein 10	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Fusion protein of Photosystem I subunit III and subunit IX × 1 （L8AII8,Q55329） Photosystem I reaction center subunit XI × 1 （L8APN7） Photosystem I reaction center subunit XII × 1 （L8ADF9） Photosystem I subunit III × 1 （L8AP84） CHLOROPHYLL A × 91 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 19 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8APJ0_9SYNC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 0； PDBConstruct 1–128； UniProt 1–128 Author chain K； PDBConstruct 1–128； UniProt 1–128 Author chain k； PDBConstruct 1–128； UniProt 1–128

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4l6v
Deposition date deposition_date	2013-06-13
Structure title title	Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
Keywords keywords	photosynthetic reaction center, membrane complex, plastocyanin, cytochrome C6, Ferredoxin, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4l6v__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4l6v__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4l6v__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.33 Å
Rg (electron density)	41.09 Å
Total Rg	41.53 Å
Atom count	22793
Residues	2178
Excluded volume	423220 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4l6v__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4l6v__assembly_2__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4l6v__assembly_3__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83036.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a,1
Atom count atom_count	68370

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b,2

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8837.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c,3

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 4 Entity 4 polymer

Description description	Photosystem I subunit II
Molecular weight formula_weight	15663.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d,4

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	8154.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e,5

MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 6 Entity 6 polymer

Description description	Fusion protein of Photosystem I subunit III and subunit IX
Molecular weight formula_weight	13855.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f,6

MDGLKSFLSTAPVMIMALLTFTAGILIEFNAFYPDLLFHPCSCAGDFLIPSIIFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Source Source

Source organism organism	Bacillus subtilis BEST7613
NCBI taxonomy ID ncbi_taxonomy_id	1204343
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16631.8 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l,8

MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m,7

MALSDTQILAALVVALLPAFLAFRLSTELYK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 9 Entity 9 polymer

Description description	Photosystem I subunit III
Molecular weight formula_weight	4414.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,9,I

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	13732.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k,0

MTAIARERGRSKRGIALHRLEYLKENQVFEIIFGEPLSMFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASSGIL

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 11 Entity 11 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	273

Entity 12 Entity 12 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 13 Entity 13 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 14 Entity 14 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	57

Entity 15 Entity 15 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 16 Entity 16 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 21 domains

CATH v4.4 (21 domains)

Domain ID domain_id	4l6v100
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4l6v200
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4l6v300
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4l6v400
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4l6v500
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4l6v600
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4l6v800
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	4l6vA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4l6vB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4l6vC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4l6vD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4l6vE00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4l6vF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4l6vL00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	4l6va00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4l6vb00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4l6vc00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4l6vd00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4l6ve00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4l6vf00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4l6vl00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	214.619 Å
Unit-cell length b length_b	133.680 Å
Unit-cell length c length_c	219.846 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	111.14 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	29.996 Å
R factor r_factor	0.2550
R_work r_work	0.2528
R_free r_free	0.2972

Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion protein of Photosystem I subunit III and subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion protein of Photosystem I subunit III and subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer