5oy0

Structure of synechocystis photosystem I trimer at 2.5A resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SYNY3
Isoform	—
PDB entities	1, 16
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751 Author chain a； PDBConstruct 1–751； UniProt 1–751 Author chain 1； PDBConstruct 1–744； UniProt 8–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P29255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SYNY3
Isoform	—
PDB entities	2, 12
Chains and sequence ranges	Author chain 2； PDBConstruct 1–731； UniProt 1–731 Author chain B； PDBConstruct 1–731； UniProt 1–731 Author chain b； PDBConstruct 1–729； UniProt 3–731

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P32422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SYNY3
Isoform	—
PDB entities	3, 13
Chains and sequence ranges	Author chain 3； PDBConstruct 1–80； UniProt 2–81 Author chain C； PDBConstruct 1–80； UniProt 2–81 Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P19569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SYNY3
Isoform	—
PDB entities	4, 17
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141 Author chain d； PDBConstruct 1–141； UniProt 1–141 Author chain 4； PDBConstruct 1–140； UniProt 2–141

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P12975

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SYNY3
Isoform	—
PDB entities	5, 14
Chains and sequence ranges	Author chain 5； PDBConstruct 1–69； UniProt 2–70 Author chain E； PDBConstruct 1–69； UniProt 2–70 Author chain e； PDBConstruct 1–68； UniProt 2–69

Photosystem I reaction center subunit III

OrganismNot specified

UniProt P29256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 6； PDBConstruct 1–143； UniProt 23–165 Author chain F； PDBConstruct 1–143； UniProt 23–165 Author chain f； PDBConstruct 1–143； UniProt 23–165

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt Q55330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_SYNY3
Isoform	—
PDB entities	7, 18
Chains and sequence ranges	Author chain I； PDBConstruct 1–40； UniProt 1–40 Author chain i； PDBConstruct 1–40； UniProt 1–40 Author chain h； PDBConstruct 1–38； UniProt 1–38

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt Q55329

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SYNY3
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–40； UniProt 1–40 Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit PsaK 2

OrganismNot specified

UniProt P74564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK2_SYNY3
Isoform	—
PDB entities	9, 15, 19
Chains and sequence ranges	Author chain K； PDBConstruct 1–80； UniProt 8–87 Author chain k； PDBConstruct 1–78； UniProt 9–86 Author chain 8； PDBConstruct 1–79； UniProt 9–87

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt P37277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SYNY3
Isoform	—
PDB entities	10, 20
Chains and sequence ranges	Author chain L； PDBConstruct 1–157； UniProt 1–157 Author chain l； PDBConstruct 1–157； UniProt 1–157 Author chain 0； PDBConstruct 1–154； UniProt 4–157

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt P72986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P29255） Photosystem I iron-sulfur center × 2 （P32422） Photosystem I reaction center subunit II × 2 （P19569） Photosystem I reaction center subunit IV × 2 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 2 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 2 （P37277） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 285 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 58 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 16 ACETATE ION × 4 beta,beta-carotene-4,4'-dione × 2 CHLORIDE ION × 3 beta,beta-caroten-4-one × 7 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 7 CALCIUM ION × 6 MAGNESIUM ION × 2 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 4 DODECYL-BETA-D-MALTOSIDE × 5 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_SYNY3
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 9； PDBConstruct 1–31； UniProt 1–31 Author chain M； PDBConstruct 1–31； UniProt 1–31 Author chain m； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5oy0
Deposition date deposition_date	2017-09-07
Structure title title	Structure of synechocystis photosystem I trimer at 2.5A resolution
Keywords keywords	photosystem I, reaction center, photosynthesis, cyanobacteria, electron transfer chain, synechocystis; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5oy0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5oy0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5oy0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.49 Å
Rg (electron density)	68.16 Å
Total Rg	68.17 Å
Atom count	76222
Residues	6771
Excluded volume	1440300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5oy0__assembly_1__model_1`	33-meric （33）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (38)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83036.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	77117

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,2

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8706.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,3

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15663.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7680.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,5

ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQ

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	15791.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f,6

ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4414.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4535.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j,7

MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit PsaK 2
Molecular weight formula_weight	8237.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16631.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m,9

MALSDTQILAALVVALLPAFLAFRLSTELYK

Entity 12 Entity 12 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81167.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

TKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 13 Entity 13 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8837.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7552.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV

Entity 15 Entity 15 polymer

Description description	Photosystem I reaction center subunit PsaK 2
Molecular weight formula_weight	8037.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLAS

Entity 16 Entity 16 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82280.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

REAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15532.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

TELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Entity 18 Entity 18 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4228.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEG

Entity 19 Entity 19 polymer

Description description	Photosystem I reaction center subunit PsaK 2
Molecular weight formula_weight	8124.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS

Entity 20 Entity 20 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16300.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

SNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN

Entity 21 Entity 21 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	285

Entity 22 Entity 22 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 23 Entity 23 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 24 Entity 24 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	58

Entity 25 Entity 25 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 26 Entity 26 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 27 Entity 27 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 28 Entity 28 non-polymer

Description description	beta,beta-carotene-4,4'-dione
Molecular weight formula_weight	564.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 30 Entity 30 non-polymer

Description description	beta,beta-caroten-4-one
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 31 Entity 31 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 32 Entity 32 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 35 Entity 35 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 36 Entity 36 non-polymer

Description description	(3'R)-3'-hydroxy-beta,beta-caroten-4-one
Molecular weight formula_weight	566.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 37 Entity 37 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 38 Entity 38 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	889

▼

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (20 domains)

Domain ID domain_id	d5oy00_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.1 — Photosystem I reaction center subunit XI, PsaL

Domain ID domain_id	d5oy01_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d5oy02_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d5oy03_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d5oy04_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d5oy05_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.2 — Photosystem I accessory protein E (PsaE)

Domain ID domain_id	d5oy06_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.1 — Subunit III of photosystem I reaction centre, PsaF

Domain ID domain_id	d5oy07_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.1 — Subunit IX of photosystem I reaction centre, PsaJ

Domain ID domain_id	d5oy08_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.30 — Photosystem I reaction center subunit X, PsaK
Superfamily Superfamily superfamily	f.30.1 — Photosystem I reaction center subunit X, PsaK
Family Family family	f.30.1.0 — automated matches

Domain ID domain_id	d5oy0a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d5oy0b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d5oy0c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d5oy0d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d5oy0e_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.2 — Photosystem I accessory protein E (PsaE)

Domain ID domain_id	d5oy0f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.1 — Subunit III of photosystem I reaction centre, PsaF

Domain ID domain_id	d5oy0h_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.17 — Subunit VIII of photosystem I reaction centre, PsaI
Family Family family	f.23.17.1 — Subunit VIII of photosystem I reaction centre, PsaI

Domain ID domain_id	d5oy0i_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.17 — Subunit VIII of photosystem I reaction centre, PsaI
Family Family family	f.23.17.1 — Subunit VIII of photosystem I reaction centre, PsaI

Domain ID domain_id	d5oy0j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.1 — Subunit IX of photosystem I reaction centre, PsaJ

Domain ID domain_id	d5oy0k_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.30 — Photosystem I reaction center subunit X, PsaK
Superfamily Superfamily superfamily	f.30.1 — Photosystem I reaction center subunit X, PsaK
Family Family family	f.30.1.0 — automated matches

Domain ID domain_id	d5oy0l_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.1 — Photosystem I reaction center subunit XI, PsaL

CATH v4.4 (24 domains)

Domain ID domain_id	5oy0000
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	5oy0100
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	5oy0200
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	5oy0300
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	5oy0400
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	5oy0500
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	5oy0600
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	5oy0700
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	5oy0A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	5oy0B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	5oy0C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	5oy0D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	5oy0E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	5oy0F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	5oy0J00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	5oy0L00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	5oy0a00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	5oy0b00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	5oy0c00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	5oy0d00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	5oy0e00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	5oy0f00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	5oy0j00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	5oy0l00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	212.170 Å
Unit-cell length b length_b	137.622 Å
Unit-cell length c length_c	225.095 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	116.74 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.501 Å
Low-resolution limit resolution_low	49.481 Å
R factor r_factor	0.2283
R_work r_work	0.2276
R_free r_free	0.2644

Structure of synechocystis photosystem I trimer at 2.5A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer