7o1v

Structure of a Minimal Photosystem I

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–739； UniProt 13–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P29255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–729； UniProt 3–731

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P32422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P19569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P12975

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–69； UniProt 2–70

Photosystem I reaction center subunit PsaK 2

OrganismNot specified

UniProt P74564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK2_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain K； PDBConstruct 1–80； UniProt 8–87

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt P72986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） CHLOROPHYLL A × 88 PHYLLOQUINONE × 2 BETA-CAROTENE × 15 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_SYNY3
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o1v
Deposition date deposition_date	2021-03-30
Structure title title	Structure of a Minimal Photosystem I
Keywords keywords	Photosystem I, excitation energy transfer, cyanobacteria, minimal structure, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o1v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o1v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o1v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.43 Å
Rg (electron density)	41.90 Å
Total Rg	42.47 Å
Atom count	20908
Residues	1869
Excluded volume	391190 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o1v__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	81722.9 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	20914

KVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81167.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8706.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15663.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7680.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQ

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit PsaK 2
Molecular weight formula_weight	8237.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MALSDTQILAALVVALLPAFLAFRLSTELYK

Entity 8 Entity 8 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	88

Entity 9 Entity 9 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 11 Entity 11 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 12 Entity 12 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 14 Entity 14 non-polymer

Description description	beta,beta-caroten-4-one
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.31 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	74303

Structure of a Minimal Photosystem I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7o1v__assembly_1__model_1

7o1v__assembly_1__model_1 | I(q)

7o1v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer