8asl

RCII/PSI complex, class 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

Synechocystis sp. PCC 6803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

Synechocystis sp. PCC 6803

UniProt P29255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–731； UniProt 1–731

Photosystem I iron-sulfur center

Synechocystis sp. PCC 6803

UniProt P32422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

Synechocystis sp. PCC 6803

UniProt P19569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

Synechocystis sp. PCC 6803

UniProt P12975

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain e； PDBConstruct 1–74； UniProt 1–74

Photosystem I reaction center subunit III

Synechocystis sp. PCC 6803

UniProt P29256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–165； UniProt 1–165

Photosystem I reaction center subunit VIII

Synechocystis sp. PCC 6803

UniProt Q55330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_SYNY3
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain i； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit IX

Synechocystis sp. PCC 6803

UniProt Q55329

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SYNY3
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit PsaK 1

Synechocystis sp. PCC 6803

UniProt P72712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK1_SYNY3
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain k； PDBConstruct 1–86； UniProt 1–86

Photosystem I reaction center subunit XI

Synechocystis sp. PCC 6803

UniProt P37277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SYNY3
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain l； PDBConstruct 1–157； UniProt 1–157

Photosystem I reaction center subunit XII

Synechocystis sp. PCC 6803

UniProt P72986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_SYNY3
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain m； PDBConstruct 1–31； UniProt 1–31

Photosystem II protein D1 2

Synechocystis sp. PCC 6803

UniProt P16033

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA2_SYNY3
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A； PDBConstruct 1–344； UniProt 1–344

Photosystem II D2 protein

Synechocystis sp. PCC 6803

UniProt P09192

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_SYNY3
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain D； PDBConstruct 8–336； UniProt 2–330

Cytochrome b559 subunit alpha

Synechocystis sp. PCC 6803

UniProt P09190

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_SYNY3
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain E； PDBConstruct 1–81； UniProt 1–81

Cytochrome b559 subunit beta

Synechocystis sp. PCC 6803

UniProt P09191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Photosystem II reaction center protein I × 1 （Q54697） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_SYNY3
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain F； PDBConstruct 1–44； UniProt 1–44

Photosystem II reaction center protein I

Synechocystis sp. PCC 6803

UniProt Q54697

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II assembly lipoprotein Ycf48 × 1 （P73069） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_SYNY3
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain I； PDBConstruct 1–38； UniProt 1–38

Photosystem II assembly lipoprotein Ycf48

Synechocystis sp. PCC 6803

UniProt P73069

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） Photosystem II protein D1 2 × 1 （P16033） Photosystem II D2 protein × 1 （P09192） Cytochrome b559 subunit alpha × 1 （P09190） Cytochrome b559 subunit beta × 1 （P09191） Photosystem II reaction center protein I × 1 （Q54697） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 101 PHYLLOQUINONE × 2 BETA-CAROTENE × 18 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 FE (II) ION × 1 PHEOPHYTIN A × 2 PROTOPORPHYRIN IX CONTAINING FE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YCF48_SYNY3
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–342； UniProt 1–342

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8asl
Deposition date deposition_date	2022-08-19
Structure title title	RCII/PSI complex, class 2
Keywords keywords	photosystem, assembly factor, membrane protein, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8asl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8asl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8asl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.35 Å
Rg (electron density)	50.47 Å
Total Rg	50.75 Å
Atom count	32739
Residues	3198
Excluded volume	609690 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8asl__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83036.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	32739

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8837.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15663.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	8154.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	18267.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MKHLLALLLAFTLWFNFAPSASADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4414.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4535.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit PsaK 1
Molecular weight formula_weight	8649.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MHSFLLATAVPATLSWSPKVAGVMIACNILAIAFGKLTIKQQNVGTPMPSSNFFGGFGLGAVLGTASFGHILGAGVILGLANMGVL

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16631.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MALSDTQILAALVVALLPAFLAFRLSTELYK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 12 Entity 12 polymer

Description description	Photosystem II protein D1 2
Molecular weight formula_weight	38280.5 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLA

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 13 Entity 13 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	37816.4 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MHHHHHHTIAVGRAPVERGWFDVLDDWLKRDRFVFIGWSGLLLFPCAFMALGGWLTGTTFVTSWYTHGLASSYLEGANFLTVAVSSPADAFGHSLLFLWGPEAQGNLTRWFQIGGLWPFVALHGAFGLIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEDSNTFRAFEPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGMRAWMA

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 14 Entity 14 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9454.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSGTTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYFTQTRQELPILQERYDINQEIQEFNQ

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 15 Entity 15 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	4935.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MATQNPNQPVTYPIFTVRWLAVHTLAVPSVFFVGAIAAMQFIQR

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 16 Entity 16 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4310.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLTLKIAVYIVVGLFISLFIFGFLSSDPTRNPGRKDFE

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 17 Entity 17 polymer

Description description	Photosystem II assembly lipoprotein Ycf48
Molecular weight formula_weight	37321.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MPVKFPSLKFEQLKQLVLVAAIAVFCVSCSHVPDLAFNPWQEIALETDSTFADIAFTEDPNHGWLVGTKETIFETTDGGDTWEQKLIDLGEEKASFSAVSFSGNEGWITGKPSILLHTTDGGQTWARIPLSEKLPGAPYSIIALGPQTAEMITDLGAIYKTTNGGKNWKALVEGAVGVARTIQRSTDGRYVAVSARGNFYSTWAPGQTEWTPHNRNSSRRLQTMGYGKDGQLWLLARGGQLQFSTDPDAEEWSDVIAPQDKGSWGLLDLSFRTPEEVWVAGASGNLLMSQDGGQTWAKDTGVEDIPANLYRVVFLSPEKGFVLGQDGILLKYNPSTEVAMVP

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	101

Entity 20 Entity 20 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 22 Entity 22 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 23 Entity 23 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 24 Entity 24 non-polymer

Description description	beta,beta-carotene-4,4'-dione
Molecular weight formula_weight	564.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 25 Entity 25 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 26 Entity 26 non-polymer

Description description	beta,beta-caroten-4-one
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	(3'R)-3'-hydroxy-beta,beta-caroten-4-one
Molecular weight formula_weight	566.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 30 Entity 30 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 32 Entity 32 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	8asld01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	8asll01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.15 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	178513

RCII/PSI complex, class 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer