8asp

RCII/PSI complex, focused refinement of PSI

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

Synechocystis sp. PCC 6803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

Synechocystis sp. PCC 6803

UniProt P29255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–731； UniProt 1–731

Photosystem I iron-sulfur center

Synechocystis sp. PCC 6803

UniProt P32422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

Synechocystis sp. PCC 6803

UniProt P19569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

Synechocystis sp. PCC 6803

UniProt P12975

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain e； PDBConstruct 1–74； UniProt 1–74

Photosystem I reaction center subunit III

Synechocystis sp. PCC 6803

UniProt P29256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–165； UniProt 1–165

Photosystem I reaction center subunit VIII

Synechocystis sp. PCC 6803

UniProt Q55330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_SYNY3
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain i； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit IX

Synechocystis sp. PCC 6803

UniProt Q55329

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SYNY3
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit PsaK 1

Synechocystis sp. PCC 6803

UniProt P72712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK1_SYNY3
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain k； PDBConstruct 1–86； UniProt 1–86

Photosystem I reaction center subunit XI

Synechocystis sp. PCC 6803

UniProt P37277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SYNY3
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain l； PDBConstruct 1–157； UniProt 1–157

Photosystem I reaction center subunit XII

Synechocystis sp. PCC 6803

UniProt P72986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 1 × 1 （P72712） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 95 PHYLLOQUINONE × 2 BETA-CAROTENE × 17 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4 beta,beta-carotene-4,4'-dione × 1 IRON/SULFUR CLUSTER × 3 beta,beta-caroten-4-one × 2 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1 ;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_SYNY3
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain m； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8asp
Deposition date deposition_date	2022-08-20
Structure title title	RCII/PSI complex, focused refinement of PSI
Keywords keywords	photosystem, assembly factor, membrane protein, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8asp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8asp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8asp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.59 Å
Rg (electron density)	41.63 Å
Total Rg	42.14 Å
Atom count	24596
Residues	2230
Excluded volume	461930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8asp__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83036.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	24596

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8837.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15663.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	8154.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	18267.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MKHLLALLLAFTLWFNFAPSASADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4414.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4535.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit PsaK 1
Molecular weight formula_weight	8805.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MHSFLLATAVPATLSWSPKVAGVMIACNILAIAFGKLTIKQQNVGTPMPSSNFFGGFGLGAVLGTASFGHILGAGVILGLANMGVLGV

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16631.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MALSDTQILAALVVALLPAFLAFRLSTELYK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 12 Entity 12 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 13 Entity 13 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	95

Entity 14 Entity 14 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 16 Entity 16 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 17 Entity 17 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 18 Entity 18 non-polymer

Description description	beta,beta-carotene-4,4'-dione
Molecular weight formula_weight	564.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 20 Entity 20 non-polymer

Description description	beta,beta-caroten-4-one
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	(3'R)-3'-hydroxy-beta,beta-caroten-4-one
Molecular weight formula_weight	566.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	8aspl01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	178513

RCII/PSI complex, focused refinement of PSI

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer