6hqb

Monomeric cyanobacterial photosystem I

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P29255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–731； UniProt 1–731

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P32422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P19569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P12975

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–69； UniProt 2–70

Photosystem I reaction center subunit III

OrganismNot specified

UniProt P29256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–143； UniProt 23–165

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt Q55330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_SYNY3
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt Q55329

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SYNY3
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit PsaK 2

OrganismNot specified

UniProt P74564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit XI × 1 （P37277） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK2_SYNY3
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–70； UniProt 18–87

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt P37277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XII × 1 （P72986） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SYNY3
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–136； UniProt 22–157

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt P72986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P29255） Photosystem I iron-sulfur center × 1 （P32422） Photosystem I reaction center subunit II × 1 （P19569） Photosystem I reaction center subunit IV × 1 （P12975） Photosystem I reaction center subunit III × 1 （P29256） Photosystem I reaction center subunit VIII × 1 （Q55330） Photosystem I reaction center subunit IX × 1 （Q55329） Photosystem I reaction center subunit PsaK 2 × 1 （P74564） Photosystem I reaction center subunit XI × 1 （P37277） CHLOROPHYLL A × 93 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 14 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 beta,beta-carotene-4,4'-dione × 1 CHLORIDE ION × 1 beta,beta-caroten-4-one × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 CALCIUM ION × 2 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 2 DODECYL-BETA-D-MALTOSIDE × 1 (3'R)-3'-hydroxy-beta,beta-caroten-4-one × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_SYNY3
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hqb
Deposition date deposition_date	2018-09-24
Structure title title	Monomeric cyanobacterial photosystem I
Keywords keywords	Crystal structure; Cyanobacteria; Membrane complexes; Photosynthesis; Photosystem I; Synechocystis, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hqb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hqb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hqb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.54 Å
Rg (electron density)	41.58 Å
Total Rg	42.11 Å
Atom count	23566
Residues	2233
Excluded volume	435410 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hqb__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (25)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83036.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	23566

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8706.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15663.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7680.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQ

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	15791.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4535.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit PsaK 2
Molecular weight formula_weight	7339.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

WSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	14523.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

TPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFNH

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MALSDTQILAALVVALLPAFLAFRLSTELYK

Entity 12 Entity 12 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	93

Entity 13 Entity 13 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 15 Entity 15 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 16 Entity 16 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	beta,beta-carotene-4,4'-dione
Molecular weight formula_weight	564.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	beta,beta-caroten-4-one
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 24 Entity 24 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 25 Entity 25 non-polymer

Description description	(3'R)-3'-hydroxy-beta,beta-caroten-4-one
Molecular weight formula_weight	566.9 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6hqbA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	6hqbB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	6hqbC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6hqbD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	6hqbE00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	6hqbF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	6hqbJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	6hqbL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	124.322 Å
Unit-cell length b length_b	178.658 Å
Unit-cell length c length_c	181.446 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	4.000 Å
Low-resolution limit resolution_low	49.289 Å
R factor r_factor	0.2560
R_work r_work	0.2552
R_free r_free	0.2950

Monomeric cyanobacterial photosystem I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer