SAXSdb — 4m6b

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera protein of Histone H2B.1 and Histone H2A.Z

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 37–131	Not recorded	Helicase SWR1 × 1 （Q05471）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% (w/v) PEG 2000 MME, 100 mM HEPES, pH 7.5, 50 mM Calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.78 Å R-free 0.220
2	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 37–131	Not recorded	Helicase SWR1 × 1 （Q05471）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% (w/v) PEG 2000 MME, 100 mM HEPES, pH 7.5, 50 mM Calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.78 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4M6B	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2JSS NMR structure of chaperone Chz1 complexed with histone H2A.Z-H2B Deposited 2007-07-11	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 37–131（95 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；308 K；Ionic strength (raw mmCIF value) 200 mM KCl；Pressure ambient NMR sample composition 1.0~1.2 mM [U-35%2H]/[U-100% 2H] H2A.Z-H2B/Chz1 \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-35%2H]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100%15N;U-100% 2H] Chz1/H2a.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C; U-100% 15N;U-100%2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-10% 13C; U-100% 15N]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-100%2H]/[U-30%2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-30%2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-13C; U-15N; U-2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-30%2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-35%2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-100%2H]/[U-30%2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-35%2H]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-30%2H]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O	Resolution not provided
4KUD Crystal structure of N-terminal acetylated Sir3 BAH domain D205N mutant in complex with yeast nucleosome core particle Deposited 2013-05-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；289 K；16% PEG 400, 0.1M KCl, 0.01M CaCl2, 0.05M sodium citrate(pH4.8), VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.20 Å R-free 0.237
4WNN SPT16-H2A-H2B FACT HISTONE Complex Deposited 2014-10-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 31–131（101 aa） Fragment：UNP residues 31-131	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；Crystals of ~ 60 x 60 mm formed within 10 days in 0.1M SPG (succinic acid:sodium dihydrogen phosphate:glycine ) pH 7, 25 % PEG 1500 (A4 of the PACT suite commercial screen (Qiagen).	Resolution 1.80 Å R-free 0.225
4WNN SPT16-H2A-H2B FACT HISTONE Complex Deposited 2014-10-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 31–131（101 aa） Fragment：UNP residues 31-131	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；Crystals of ~ 60 x 60 mm formed within 10 days in 0.1M SPG (succinic acid:sodium dihydrogen phosphate:glycine ) pH 7, 25 % PEG 1500 (A4 of the PACT suite commercial screen (Qiagen).	Resolution 1.80 Å R-free 0.225
4WNN SPT16-H2A-H2B FACT HISTONE Complex Deposited 2014-10-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 31–131（101 aa） Fragment：UNP residues 31-131	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；Crystals of ~ 60 x 60 mm formed within 10 days in 0.1M SPG (succinic acid:sodium dihydrogen phosphate:glycine ) pH 7, 25 % PEG 1500 (A4 of the PACT suite commercial screen (Qiagen).	Resolution 1.80 Å R-free 0.225
4WNN SPT16-H2A-H2B FACT HISTONE Complex Deposited 2014-10-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 31–131（101 aa） Fragment：UNP residues 31-131	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；Crystals of ~ 60 x 60 mm formed within 10 days in 0.1M SPG (succinic acid:sodium dihydrogen phosphate:glycine ) pH 7, 25 % PEG 1500 (A4 of the PACT suite commercial screen (Qiagen).	Resolution 1.80 Å R-free 0.225
5BT1 histone chaperone Hif1 playing with histone H2A-H2B dimer Deposited 2015-06-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–131（131 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；287 K；0.1M Magnesium formate dihydrate, 15% PEG3350	Resolution 2.62 Å R-free 0.262
6AE8 Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement Deposited 2018-08-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 37–131（95 aa） Fragment：UNP residues 37-131, UNP residues 23-119	Not recorded	BCN BICINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；Bicine,1,4-Dioxane,PEG 20000	Resolution 1.65 Å R-free 0.216
6AE8 Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement Deposited 2018-08-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 37–131（95 aa） Fragment：UNP residues 37-131, UNP residues 23-119	Not recorded	BCN BICINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；Bicine,1,4-Dioxane,PEG 20000	Resolution 1.65 Å R-free 0.216
6GEJ Chromatin remodeller-nucleosome complex at 3.6 A resolution. Deposited 2018-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain G 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6GEN Chromatin remodeller-nucleosome complex at 4.5 A resolution. Deposited 2018-04-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain G 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6QLD Structure of inner kinetochore CCAN-Cenp-A complex Deposited 2019-01-31	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain h 36–129（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.15 Å
7K78 antibody and nucleosome complex Deposited 2020-09-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.10 Å
7K7G nucleosome and Gal4 complex Deposited 2020-09-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
7SSA Cryo-EM structure of pioneer factor Cbf1 bound to the nucleosome Deposited 2021-11-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain D 2–131（130 aa） Chain H 2–131（130 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8OW0 Cryo-EM structure of CBF1-CCAN bound topologically to a centromeric CENP-A nucleosome Deposited 2023-04-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 23 PDB declaration: 25-meric	Chain d 1–131（131 aa） Chain h 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8OW1 Cryo-EM structure of the yeast Inner kinetochore bound to a CENP-A nucleosome. Deposited 2023-04-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 40 PDB declaration: 42-meric	Chain d 1–131（131 aa） Chain h 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8QKU SWR1-nucleosome complex in configuration 1 Deposited 2023-09-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain G 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8QKV SWR1-nucleosome complex in configuration 2 Deposited 2023-09-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain G 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8QYV SWR1-hexasome complex Deposited 2023-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 17 PDB declaration: 19-meric	Chain G 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8QZ0 SWR1-hexasome-dimer complex Deposited 2023-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain G 1–131（131 aa） Chain H 1–131（131 aa）	Mutation：S115C	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9C9G S.c INO80 in complex with S.c 0/80 nucleosome Deposited 2024-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 20-meric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen OTHER	Resolution 2.91 Å
9C9T S.c INO80 in complex with S.c 0/40 nucleosome, Class 2 Deposited 2024-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 20-meric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen OTHER	Resolution 3.16 Å
9CAU DeltaArp8 INO80 bound to S.c 0/40 nucleosome, Nucleosome Deposited 2024-06-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 8 PDB declaration: decameric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen OTHER	Resolution 4.18 Å
9CB7 DeltaNhp10 INO80 bound to S.c 0/40 nucleosome, Ino80-Nucleosome Deposited 2024-06-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: 12-meric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen OTHER	Resolution 4.04 Å
9FBW SWR1 lacking Swc5 subunit in complex with hexasome Deposited 2024-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain G 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
9OB1 S.c INO80 in complex with Yeast 0/80 nucleosome, Apo State Deposited 2025-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain D 1–131（131 aa） Chain H 1–131（131 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen OTHER	Resolution 3.20 Å

23 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	H2B1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–96； UniProt 37–131 Author chain D； PDBConstruct 2–96； UniProt 37–131

Chimera protein of Histone H2B.1 and Histone H2A.Z

Saccharomyces cerevisiae

UniProt Q12692

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 23–119	Not recorded	Helicase SWR1 × 1 （Q05471）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% (w/v) PEG 2000 MME, 100 mM HEPES, pH 7.5, 50 mM Calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.78 Å R-free 0.220
2	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 23–119	Not recorded	Helicase SWR1 × 1 （Q05471）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% (w/v) PEG 2000 MME, 100 mM HEPES, pH 7.5, 50 mM Calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.78 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4M6B	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2JSS NMR structure of chaperone Chz1 complexed with histone H2A.Z-H2B Deposited 2007-07-11	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 23–119（97 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；308 K；Ionic strength (raw mmCIF value) 200 mM KCl；Pressure ambient NMR sample composition 1.0~1.2 mM [U-35%2H]/[U-100% 2H] H2A.Z-H2B/Chz1 \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-35%2H]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100%15N;U-100% 2H] Chz1/H2a.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C; U-100% 15N;U-100%2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-10% 13C; U-100% 15N]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-100%2H]/[U-30%2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-30%2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-13C; U-15N; U-2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-30%2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-35%2H]/[U-100% 2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-100%2H]/[U-30%2H] H2A.Z-H2B/Chz1, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 13C;U-35%2H]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O NMR sample composition 1.0~1.2 mM [U-100% 15N;U-30%2H]/[U-100% 2H] Chz1/H2A.Z-H2B, 25 mM MES, 200 mM KCl, 1mM EDTA \| 90% H2O/10% D2O/100%D2O	Resolution not provided
6AE8 Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement Deposited 2018-08-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 23–119（97 aa） Fragment：UNP residues 37-131, UNP residues 23-119	Not recorded	BCN BICINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；Bicine,1,4-Dioxane,PEG 20000	Resolution 1.65 Å R-free 0.216
6AE8 Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement Deposited 2018-08-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 23–119（97 aa） Fragment：UNP residues 37-131, UNP residues 23-119	Not recorded	BCN BICINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；Bicine,1,4-Dioxane,PEG 20000	Resolution 1.65 Å R-free 0.216
8QZ0 SWR1-hexasome-dimer complex Deposited 2023-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain L 1–134（134 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å

3 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	H2AZ_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 97–193； UniProt 23–119 Author chain D； PDBConstruct 97–193； UniProt 23–119

Helicase SWR1

Saccharomyces cerevisiae

UniProt Q05471

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 590–639	Fragment：Swr1-Z domain	Chimera protein of Histone H2B.1 and Histone H2A.Z × 1 （P02293,Q12692）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% (w/v) PEG 2000 MME, 100 mM HEPES, pH 7.5, 50 mM Calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.78 Å R-free 0.220
2	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 590–639	Fragment：Swr1-Z domain	Chimera protein of Histone H2B.1 and Histone H2A.Z × 1 （P02293,Q12692）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% (w/v) PEG 2000 MME, 100 mM HEPES, pH 7.5, 50 mM Calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.78 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4M6B	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5I9E Crystal structure of a nuclear actin ternary complex Deposited 2016-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 340–410（71 aa） Fragment：UNP residues 340-410	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；291 K；polyethylene glycol (PEG) 3350, citric acid, BIS-TRIS propane	Resolution 2.80 Å R-free 0.284
5I9E Crystal structure of a nuclear actin ternary complex Deposited 2016-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 340–410（71 aa） Fragment：UNP residues 340-410	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；291 K；polyethylene glycol (PEG) 3350, citric acid, BIS-TRIS propane	Resolution 2.80 Å R-free 0.284
6GEJ Chromatin remodeller-nucleosome complex at 3.6 A resolution. Deposited 2018-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
6GEN Chromatin remodeller-nucleosome complex at 4.5 A resolution. Deposited 2018-04-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8QKU SWR1-nucleosome complex in configuration 1 Deposited 2023-09-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8QKV SWR1-nucleosome complex in configuration 2 Deposited 2023-09-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: eicosameric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8QYV SWR1-hexasome complex Deposited 2023-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 17 PDB declaration: 19-meric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8QZ0 SWR1-hexasome-dimer complex Deposited 2023-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 22-meric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9FBW SWR1 lacking Swc5 subunit in complex with hexasome Deposited 2024-05-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 16 PDB declaration: 18-meric	Chain M 1–1514（1514 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 8 BEF BERYLLIUM TRIFLUORIDE ION × 2 MG MAGNESIUM ION × 8 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å

8 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SWR1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 5–54； UniProt 590–639 Author chain F； PDBConstruct 5–54； UniProt 590–639

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4m6b
Deposition date deposition_date	2013-08-09
Structure title title	Crystal structure of yeast Swr1-Z domain in complex with H2A.Z-H2B dimer
Keywords keywords	Chromatin remodeler, Histone binding, Structural Protein-Hydrolase complex; Structural Protein/Hydrolase
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.65 Å
Radius of gyration Rg (electron density) rg_electron	30.64 Å
Forward intensity I(0) i0	34045600.00
Molecular weight molecular_weight	45586.0 kDa
Excluded volume excluded_volume	57274 Å³
Envelope volume envelope_volume	72944 Å³
Hydration-shell volume shell_volume	22303 Å³
Envelope diameter envelope_diameter	115.0 Å
Shell Rg shell_rg	33.49 Å
Envelope Rg envelope_rg	31.14 Å
Shape Rg shape_rg	30.60 Å
Total Rg total_rg	31.04 Å
Total atoms total_atoms	3211
Residues n_residues	418
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	109.3 Å
Rg (real space) rg_real	31.17 Å
Rg uncertainty (real space) rg_real_error	1.18 Å
I(0) (real space) i0_real	3.4050e+07
I(0) uncertainty (real space) i0_real_error	5.6160e+05
Rg (reciprocal space) rg_reciprocal	30.95 Å
I(0) (reciprocal space) i0_reciprocal	34040000.0000
Solution quality estimate total_estimate	0.5260
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.1 Å
Skewness Skewness skewness	0.611
Kurtosis Kurtosis kurtosis	-0.437
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	12790000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.374; Stabil: 1.000; Sysdev: 0.193; Positv: 1.000; Valcen: 0.231; Smooth: 0.901

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Chimera protein of Histone H2B.1 and Histone H2A.Z
Molecular weight formula_weight	21205.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	3398

MRKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHI

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;Baker's yeast ;
NCBI Class编号 ncbi_taxonomy_id	559292
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Helicase SWR1
Molecular weight formula_weight	5970.1 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F

GSHMDRESDDKTPSVGLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDW

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;Baker's yeast ;
NCBI Class编号 ncbi_taxonomy_id	559292
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	187

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4m6ba1
Class class	a — All alpha proteins
Fold Fold fold	a.22 — Histone-fold
Superfamily Superfamily superfamily	a.22.1 — Histone-fold
Family Family family	a.22.1.1 — Nucleosome core histones

Domain ID domain_id	d4m6ba2
Class class	a — All alpha proteins
Fold Fold fold	a.22 — Histone-fold
Superfamily Superfamily superfamily	a.22.1 — Histone-fold
Family Family family	a.22.1.1 — Nucleosome core histones

Domain ID domain_id	d4m6bd1
Class class	a — All alpha proteins
Fold Fold fold	a.22 — Histone-fold
Superfamily Superfamily superfamily	a.22.1 — Histone-fold
Family Family family	a.22.1.1 — Nucleosome core histones

Domain ID domain_id	d4m6bd2
Class class	a — All alpha proteins
Fold Fold fold	a.22 — Histone-fold
Superfamily Superfamily superfamily	a.22.1 — Histone-fold
Family Family family	a.22.1.1 — Nucleosome core histones

CATH v4.4 (2 domains)

Domain ID domain_id	4m6bA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	4m6bD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

▶

8. Citations (1)

▶

Unit-cell length a length_a	65.667 Å
Unit-cell length b length_b	69.917 Å
Unit-cell length c length_c	101.724 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.780 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2260
R_work r_work	0.2110
R_free r_free	0.2200

fit	/app/data/saxs_computation/m6/4m6b/4m6b.fit
pddf	/app/data/pr_computation/m6/4m6b/4m6b.pr.out
profile	/app/data/saxs_computation/m6/4m6b/4m6b.dat

Crystal structure of yeast Swr1-Z domain in complex with H2A.Z-H2B dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera protein of Histone H2B.1 and Histone H2A.Z

State in the Current Structure

Other States of the Same Protein in the Database

Chimera protein of Histone H2B.1 and Histone H2A.Z

State in the Current Structure

Other States of the Same Protein in the Database

Helicase SWR1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)