9fbw

SWR1 lacking Swc5 subunit in complex with hexasome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3

Saccharomyces cerevisiae S288C

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–136； UniProt 1–136 Author chain B； PDBConstruct 1–136； UniProt 1–136

Histone H4

Saccharomyces cerevisiae S288C

UniProt P02309

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–103； UniProt 1–103 Author chain D； PDBConstruct 1–103； UniProt 1–103

Histone H2A.1

Saccharomyces cerevisiae S288C

UniProt P04911

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–132； UniProt 1–132

Histone H2B.1

Saccharomyces cerevisiae S288C

UniProt P02293

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–131； UniProt 1–131

Helicase SWR1

Saccharomyces cerevisiae S288C

UniProt Q05471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWR1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–1514； UniProt 1–1514

Actin-like protein ARP6

Saccharomyces cerevisiae S288C

UniProt Q12509

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP6_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain R； PDBConstruct 1–438； UniProt 1–438

Vacuolar protein sorting-associated protein 71

Saccharomyces cerevisiae S288C

UniProt Q03433

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPS71_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain S； PDBConstruct 1–280； UniProt 1–280

RuvB-like protein 1

Saccharomyces cerevisiae S288C

UniProt Q03940

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 2 × 3 （Q12464） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB1_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain T； PDBConstruct 1–463； UniProt 1–463 Author chain V； PDBConstruct 1–463； UniProt 1–463 Author chain X； PDBConstruct 1–463； UniProt 1–463

RuvB-like protein 2

Saccharomyces cerevisiae S288C

UniProt Q12464

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） Vacuolar protein sorting-associated protein 72 × 1 （Q03388） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB2_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain U； PDBConstruct 1–471； UniProt 1–471 Author chain W； PDBConstruct 1–471； UniProt 1–471 Author chain Y； PDBConstruct 1–471； UniProt 1–471

Vacuolar protein sorting-associated protein 72

Saccharomyces cerevisiae S288C

UniProt Q03388

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 2 （P02309） Histone H2A.1 × 1 （P04911） Histone H2B.1 × 1 （P02293） DNA (112-MER) × 1 DNA (112-MER) × 1 Helicase SWR1 × 1 （Q05471） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 （Q03940） RuvB-like protein 2 × 3 （Q12464） ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPS72_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Z； PDBConstruct 1–795； UniProt 1–795

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9fbw
Deposition date deposition_date	2024-05-14
Structure title title	SWR1 lacking Swc5 subunit in complex with hexasome
Keywords keywords	Chromatin remodelling complex, hexasome, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9fbw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9fbw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9fbw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.01 Å
Rg (electron density)	63.50 Å
Total Rg	63.70 Å
Atom count	39683
Residues	4746
Excluded volume	694100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9fbw__assembly_1__model_1`	18-meric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Histone H3
Molecular weight formula_weight	15405.0 kDa
Mutation mutation	Q120M, K121P, K125Q
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	39683

MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKEIKLARRLRGERS

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H4
Molecular weight formula_weight	11395.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H2A.1
Molecular weight formula_weight	14013.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQEL

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Histone H2B.1
Molecular weight formula_weight	14280.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQA

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	DNA (112-MER)
Molecular weight formula_weight	34362.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	I

CCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCC

Entity 6 Entity 6 polymer

Description description	DNA (112-MER)
Molecular weight formula_weight	34763.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	J

GGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGG

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 7 Entity 7 polymer

Description description	Helicase SWR1
Molecular weight formula_weight	174793.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MTTSRKSHAKDKKAGGEQDLADLKFRYDLLTNELFHLREFVSLVDYDPTHFNDSESFQKFLRETHLSLEERGEKFTDDVAKKGTNGDLTRRRRNLRTSTVVSSETTNEKKGDIELKLESIAPLVRNKCEELKYKLSDHSNRKSIVPQKRPIQHLKKREAAKSLKFKSERKENPLPLHEHIAEERYDHIAKVEEPSEAFTIKCPSDDSSFENTSEHYSDNFYFTTSSEEEDIKKKRGRKKKKPRIKLVVHPPKQTITNPLHVVKPGYESLHEYIASFKSLEDDLTLEEYNKYIDEQRRLLSRLKKGIENGALKYDKETDSLQPITSKEIKTIITYKPDPISYFYKQQDLQIHTDHLINQGIHMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERKAKEEERHKKSLARFAVQAVKKRWNMAEKAYRILRKDEEEQLKRIEGKQHLSKMLEKSTQLLEAQLNQVNDDGRSSTPSSDSNDVLSESDDDMDDELSTSSDEDEEVDADVGLENSPASTEATPTDESLNLIQLKEKYGHFNGSSTVYDSRNKDEKFPTLDKHESSSSESSVMTGEESSIYSSSENESQNENDRESDDKTPSVGLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDQVDNSAATFERAGDFVHTQNENRDDIKDVEEDAETKVQEEQLSVVDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPNLFEVRPILTSFVLEHCVASDYKDVERTLLKLFKKNNQVNRVDLDFLNLVFTLNDKDLTSYHAEEISKLTCVKNFVEEVNKLRETNKQLQEEFGEASFLNFQDANQYFKYSNKQKLEGTVDMLNFLKMVNKLRCDRRPIFGKNLIDLLTKDRRVKYDKSSIIDNELIKPLQTRVLDNRKIIDTFAVLTPSAVSLDMRKLALGLNDDSSVGENTRLKVMQNCFEVSNPLHQLQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLLGSELPENASGGDKPLIADADVAAKDPRQLERLLAQAEDEDDVKAANLAMREVEIDNDDFDESTEKKAANEEEENHAELDEYEGTAHVDEYMIRFIANGYYY

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Actin-like protein ARP6
Molecular weight formula_weight	50100.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRFGYQNWI

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Vacuolar protein sorting-associated protein 71
Molecular weight formula_weight	32073.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MKALVEEIDKKTYNPDIYFTSLDPQARRYTSKKINKQGTISTSRPVKRINYSLADLEARLYTSRSEGDGNSISRQDDRNSKNSHSFEERYTQQEILQSDRRFMELNTENFSDLPNVPTLLSDLTGVPRDRIESTTKPISQTSDGLSALMGGSSFVKEHSKYGHGWVLKPETLREIQLSYKSTKLPKPKRKNTNRIVALKKVLSSKRNLHSFLDSALLNLMDKNVIYHNVYNKRYFKVLPLITTCSICGGYDSISSCVNCGNKICSVSCFKLHNETRCRNR

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	RuvB-like protein 1
Molecular weight formula_weight	50516.9 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,V,X

MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYL

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	RuvB-like protein 2
Molecular weight formula_weight	51673.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,W,Y

MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Vacuolar protein sorting-associated protein 72
Molecular weight formula_weight	90709.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSDEGADKSLDTNTEFIIQTRSRRSNAGNKLQKLLEQELRDIESTKRQISSYKNGNDDEEDEIGLLFQEDEDDEDFEMMAKDDDDEGEEKEDETQSIRKEPSQASSEQAADDLMFSSSESEDSSNENDEDAEEKEIRRQELLSRKKRNKRLQKGPVVIKKQKPKPKSGEAIPRSHHTHEQLNAETLLLNTRRTSKRSSVMENTMKVYEKLSKAEKKRKIIQERIRKHKEQESQHMLTQEERLRIAKETEKLNILSLDKFKEQEVWKKENRLALQKRQKQKFQPNETILQFLSTAWLMTPAMELEDRKYWQEQLNKRDKKKKKYPRKPKKNLNLGKQDASDDKKRESEESIKNDGDVNSLGENSSSVHNQKRIEETSTNDTVEGESSPDAAVSRVNSDELKPTALPDVTLDAIANKQSTVDEAPNSQPQKNIITNEQKITNVGEPIQNLHNEEIKDEMVSALESRENTFENSSPAAQVVSQRDNSATPTPSNSTGTEDTILISPDTDIKGEPEPCLKTEGIENLSHNVPQETKSNTDVSFLKQVTFTDHPQVAIIDTEESPSKKDTANVDESSAENSLSTQTYEGPEQLTSRNFVTLYDFPNAPPNLKDFNTNLFGDRWSYTNGLSATQRPQDMKTVFHSILPSPPQSSVPSPTVDISLDLSALANFPSFGEYDKKIVHQINTEINKDLEIKIKTQPPTGVFLANGIRKKCLITNKECQYFDPRTGVPYSDVEAYKIIQRIQDPISKEEGRSDIKRDETTNEDSDDQVRFKWFGFKNGGIYLDLSQRPAKGVPEGF

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 14 Entity 14 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	57997

SWR1 lacking Swc5 subunit in complex with hexasome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Helicase SWR1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-like protein ARP6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 71

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 72

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer