7z0o

Structure of transcription factor UAF in complex with TBP and 35S rRNA promoter DNA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H4 × 1 （P02309） RNA polymerase I-specific transcription initiation factor RRN5 × 1 （Q02983） RNA polymerase I-specific transcription initiation factor RRN9 × 1 （P53437） RNA polymerase I-specific transcription initiation factor RRN10 × 1 （P38204） Upstream activation factor subunit UAF30 × 1 （Q08747） TATA-box-binding protein × 1 （P13393） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–136； UniProt 1–136 Author chain C； PDBConstruct 1–136； UniProt 1–136

Histone H4

Saccharomyces cerevisiae

UniProt P02309

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H3 × 2 （P61830） RNA polymerase I-specific transcription initiation factor RRN5 × 1 （Q02983） RNA polymerase I-specific transcription initiation factor RRN9 × 1 （P53437） RNA polymerase I-specific transcription initiation factor RRN10 × 1 （P38204） Upstream activation factor subunit UAF30 × 1 （Q08747） TATA-box-binding protein × 1 （P13393） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–103； UniProt 1–103

RNA polymerase I-specific transcription initiation factor RRN5

Saccharomyces cerevisiae

UniProt Q02983

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 1 （P02309） RNA polymerase I-specific transcription initiation factor RRN9 × 1 （P53437） RNA polymerase I-specific transcription initiation factor RRN10 × 1 （P38204） Upstream activation factor subunit UAF30 × 1 （Q08747） TATA-box-binding protein × 1 （P13393） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN5_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 2–364； UniProt 1–363

RNA polymerase I-specific transcription initiation factor RRN9

Saccharomyces cerevisiae

UniProt P53437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 1 （P02309） RNA polymerase I-specific transcription initiation factor RRN5 × 1 （Q02983） RNA polymerase I-specific transcription initiation factor RRN10 × 1 （P38204） Upstream activation factor subunit UAF30 × 1 （Q08747） TATA-box-binding protein × 1 （P13393） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN9_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 2–366； UniProt 1–365

RNA polymerase I-specific transcription initiation factor RRN10

Saccharomyces cerevisiae

UniProt P38204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 1 （P02309） RNA polymerase I-specific transcription initiation factor RRN5 × 1 （Q02983） RNA polymerase I-specific transcription initiation factor RRN9 × 1 （P53437） Upstream activation factor subunit UAF30 × 1 （Q08747） TATA-box-binding protein × 1 （P13393） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRN10_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–145； UniProt 1–145

Upstream activation factor subunit UAF30

Saccharomyces cerevisiae

UniProt Q08747

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 1 （P02309） RNA polymerase I-specific transcription initiation factor RRN5 × 1 （Q02983） RNA polymerase I-specific transcription initiation factor RRN9 × 1 （P53437） RNA polymerase I-specific transcription initiation factor RRN10 × 1 （P38204） TATA-box-binding protein × 1 （P13393） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UAF30_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–228； UniProt 1–228

TATA-box-binding protein

Saccharomyces cerevisiae

UniProt P13393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 8 DNA 2	Histone H3 × 2 （P61830） Histone H4 × 1 （P02309） RNA polymerase I-specific transcription initiation factor RRN5 × 1 （Q02983） RNA polymerase I-specific transcription initiation factor RRN9 × 1 （P53437） RNA polymerase I-specific transcription initiation factor RRN10 × 1 （P38204） Upstream activation factor subunit UAF30 × 1 （Q08747） Non-template DNA × 1 Template DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 3–242； UniProt 1–240

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7z0o
Deposition date deposition_date	2022-02-23
Structure title title	Structure of transcription factor UAF in complex with TBP and 35S rRNA promoter DNA
Keywords keywords	Transcription Factor, Nucleolus, Histone Fold, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7z0o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7z0o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7z0o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.71 Å
Rg (electron density)	39.38 Å
Total Rg	39.95 Å
Atom count	11864
Residues	1334
Excluded volume	207250 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7z0o__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Histone H3
Molecular weight formula_weight	15391.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	11864

MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Histone H4
Molecular weight formula_weight	11395.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN5
Molecular weight formula_weight	41873.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

SMEHQQLRKYVELYNKEVEEFYNGAASGRPAEFHPSKVHVKSIHEKAGTANAGVEISSVGVDWDSEEKNTFFWCLSRYSIHRVDEWRSLLPRKSAMEILGYYRLLRRASASARSRKAGDDGAPIAYEMSAEWVALETKLSETVMAITEGAAEVADEEGHCEGLIDYESWKRRWVAIYSHSRIAEIRPLPRHALPLSRSATQTLERCVSRYTRTLLWCTALAGMASRSVSARAAESRGHKSLPTVVTRRQVERALCTEARSRDLHVLPRRIVLTLRKWELDYPREGKLFRTKEMAHLFLQSQLSRRDAPPVHQDENQENQENQENQEQDNTASEGESEAERDEIDEADLFRSALHENQLLKWLSK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN9
Molecular weight formula_weight	42964.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

SMSDLDEESQIETQIDAPIEDIIRGSELTTTTADKETLKSANELLDSLEHSHRVDLSLHLYSAYLLKRLLYKANEKKHFYEVNQFVKTQIKDNWTSWPNPNTIIDPSVDKLYEDIPEGIANVSVQPGEISNRALMHASDMMRVELDAQWQKFLSKSALDHDVTLDVDELNIPNEISRNILVKLDSLFEGLHDKIAKENEFDVRQDKHSNNIRANQIDDEPMQANRRIKYTYHDLVSRGCEMNEDMTDIYMKSLELYNDIPEKYKKRKFRLPKQILKKYHQPKKTSSYLKELLSKTREDFIPVEKLLKDKRLTSKDKSKLQRLNREETEDALNKRTFFQVKGYLEDENEISDYELDDCLIELPNGNI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	RNA polymerase I-specific transcription initiation factor RRN10
Molecular weight formula_weight	16525.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MDRNVYEACSNIIKEFGTHVVSADEVLAEKIDNAVPIPFKTREEIDADVEKDRNEGVFEGNIIPDIDLRVVHYYATQLCLNKYPHLINAFDETSLITLGLLIEKWVKDYLTSIQTEQGRQSKVIGKGPCEFISKHIDYRHAPGNI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	Upstream activation factor subunit UAF30
Molecular weight formula_weight	26014.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAELNDYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKERPRFERSLEDLLKENATLAIELTKEITVSKRSSGEEKNDSETKGTHVEKKKGTVSKSPISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKSTNMFEMHKILASHMTEPKKISDCPPLIQEVRRKEKPIVSDSEQSDTKGI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 7 Entity 7 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	27237.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

GHMADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 8 Entity 8 polymer

Description description	Non-template DNA
Molecular weight formula_weight	47265.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

GAAAAAAAAAATATACGCTAAGATTTTTGGAGAATAGCTTAAATTGAAGTTTTTCTCGGCGAGAAATACGTAGTTAAGGCAGAGCGACAGAGAGGGCAAAAGAAAATAAAAGTAAGATTTTAGTTTGTAATGGGAGGGGGGGTTTAGTCAT

Entity 9 Entity 9 polymer

Description description	Template DNA
Molecular weight formula_weight	45924.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

ATGACTAAACCCCCCCTCCCATTACAAACTAAAATCTTACTTTTATTTTCTTTTGCCCTCTCTGTCGCTCTGCCTTAACTACGTATTTCTCGCCGAGAAAAACTTCAATTTAAGCTATTCTCCAAAAATCTTAGCGTATATTTTTTTTTTC

▶

Resolution resolution	2.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	193226

Structure of transcription factor UAF in complex with TBP and 35S rRNA promoter DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase I-specific transcription initiation factor RRN10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Upstream activation factor subunit UAF30

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TATA-box-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7z0o__assembly_1__model_1

7z0o__assembly_1__model_1 | I(q)

7z0o__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer