SAXSdb — 4rws

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-X-C chemokine receptor type 4/Endolysin chimeric protein

Enterobacteria phage T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Viral macrophage inflammatory protein 2 × 1 （Q98157）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LYS_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 238–397； UniProt 1002–1161

C-X-C chemokine receptor type 4/Endolysin chimeric protein

Enterobacteria phage T4

UniProt P61073

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Viral macrophage inflammatory protein 2 × 1 （Q98157）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CXCR4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–237； UniProt 2–228 Author chain A； PDBConstruct 401–489； UniProt 231–319

Viral macrophage inflammatory protein 2

Human herpesvirus 8 strain GK18

UniProt Q98157

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	C-X-C chemokine receptor type 4/Endolysin chimeric protein × 1 （P00720,P61073）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VMI2_HHV8P
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–71； UniProt 24–94

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4rws
Deposition date deposition_date	2014-12-05
Structure title title	Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community Target)
Keywords keywords	;Human chemokine-chemokine receptor complex, GPCR signaling, PSI-Biology, GPCR network, membrane protein, GPCR, CXCR4, viral antagonist chemokine vMIP-II, membrane, lipidic cubic phase, T4L, Structural Genomics, SIGNALING PROTEIN, HYDROLASE ;; SIGNALING PROTEIN, HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4rws__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4rws__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4rws__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.60 Å
Rg (electron density)	32.08 Å
Total Rg	32.54 Å
Atom count	3953
Residues	508
Excluded volume	71411 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4rws__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	C-X-C chemokine receptor type 4/Endolysin chimeric protein
Molecular weight formula_weight	56602.5 kDa
EC 编号 ec_number	3.2.1.17
Mutation mutation	L125W, T240P, D187C, C1054T, C1097T
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3953

DYKDDDDGAPEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICCRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYSGSGHQKRKALKPTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSGRPLEVLFQ

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Viral macrophage inflammatory protein 2
Molecular weight formula_weight	9143.7 kDa
Mutation mutation	W5C
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

LGASCHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTARYPYDVPDYA

Source Source

Source organism organism	Human herpesvirus 8 strain GK18
Common name common_name	HHV-8
NCBI taxonomy ID ncbi_taxonomy_id	868565
Host organism host_organism	Spodoptera frugiperda

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d4rwsc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.9 — IL8-like
Superfamily Superfamily superfamily	d.9.1 — Interleukin 8-like chemokines
Family Family family	d.9.1.1 — Interleukin 8-like chemokines

CATH v4.4 (1 domains)

Domain ID domain_id	4rwsC00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	40 —

▶

Unit-cell length a length_a	82.320 Å
Unit-cell length b length_b	121.827 Å
Unit-cell length c length_c	189.766 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2505
R_work r_work	0.2493
R_free r_free	0.2739

Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community Target)

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-X-C chemokine receptor type 4/Endolysin chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

C-X-C chemokine receptor type 4/Endolysin chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Viral macrophage inflammatory protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4rws__assembly_1__model_1

4rws__assembly_1__model_1 | I(q)

4rws__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community Target)

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-X-C chemokine receptor type 4/Endolysin chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-X-C chemokine receptor type 4/Endolysin chimeric protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Viral macrophage inflammatory protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4rws__assembly_1__model_1

4rws__assembly_1__model_1 | I(q)

4rws__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)