5hob

p73 homo-tetramerization domain mutant I

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein p73

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	water × 4	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	MAGNESIUM ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P73_HUMAN
Isoform	O15350-1
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–50； UniProt 351–398 Author chain B； PDBConstruct 3–50； UniProt 351–398 Author chain C； PDBConstruct 3–50； UniProt 351–398 Author chain D； PDBConstruct 3–50； UniProt 351–398 Author chain E； PDBConstruct 3–50； UniProt 351–398 Author chain F； PDBConstruct 3–50； UniProt 351–398 Author chain G； PDBConstruct 3–50； UniProt 351–398 Author chain H； PDBConstruct 3–50； UniProt 351–398

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5hob
Deposition date deposition_date	2016-01-19
Structure title title	p73 homo-tetramerization domain mutant I
Keywords keywords	transcription factor, tetramerization domain, p73, homo-tetramerization mutant, hetero-tetramerization, transcription; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5hob__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5hob__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5hob__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.25 Å
Rg (electron density)	17.13 Å
Total Rg	18.00 Å
Atom count	2898
Residues	180
Excluded volume	26256 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5hob__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5hob__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tumor protein p73
Molecular weight formula_weight	6034.8 kDa
Mutation mutation	E363K, K370E, E373R, R390E
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	6145

GSDEDTYYLQVRGRKNFEILMELKRSLELMELVPQPLVDSYEQQQQLLQR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	376

▼

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (10 domains)

Domain ID domain_id	d5hoba_
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobb_
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobc_
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobd_
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobe1
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobe2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5hobf_
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobg_
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobh1
Class class	a — All alpha proteins
Fold Fold fold	a.53 — p53 tetramerization domain
Superfamily Superfamily superfamily	a.53.1 — p53 tetramerization domain
Family Family family	a.53.1.0 — automated matches

Domain ID domain_id	d5hobh2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (8 domains)

Domain ID domain_id	5hobA00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobB00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobC00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobD00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobE00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobF00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobG00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

Domain ID domain_id	5hobH00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	170 — p53, subunit A
Homologous superfamily homologous superfamily	10 — p53-like tetramerisation domain

▶

Unit-cell length a length_a	29.050 Å
Unit-cell length b length_b	48.400 Å
Unit-cell length c length_c	75.730 Å
Unit-cell angle α angle_alpha	89.60 °
Unit-cell angle β angle_beta	83.20 °
Unit-cell angle γ angle_gamma	74.27 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.220 Å
Low-resolution limit resolution_low	46.570 Å
R factor r_factor	0.1896
R_work r_work	0.1884
R_free r_free	0.2142

p73 homo-tetramerization domain mutant I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein p73

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5hob__assembly_1__model_1

5hob__assembly_1__model_1 | I(q)

5hob__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (10 domains)

CATH v4.4 (8 domains)

7. Citations (1)

p73 homo-tetramerization domain mutant I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein p73

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5hob__assembly_1__model_1

5hob__assembly_1__model_1 | I(q)

5hob__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (10 domains)

CATH v4.4 (8 domains)

7. Citations (1)