6adq

Respiratory Complex CIII2CIV2SOD2 from Mycobacterium smegmatis

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R057_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–341； UniProt 1–341 Author chain Q； PDBConstruct 1–341； UniProt 1–341

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt A0R049

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R049_MYCS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–203； UniProt 1–203 Author chain S； PDBConstruct 1–203； UniProt 1–203

Cytochrome c oxidase polypeptide 4

OrganismNot specified

UniProt A0R056

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R056_MYCS2
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–139； UniProt 1–139 Author chain T； PDBConstruct 1–139； UniProt 1–139

Cytochrome c oxidase subunit CtaJ

OrganismNot specified

UniProt A0R1B6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R1B6_MYCS2
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–79； UniProt 1–79 Author chain U； PDBConstruct 1–79； UniProt 1–79

Uncharacterized protein MSMEG_4692/MSMEI_4575

OrganismNot specified

UniProt A0R1B5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y4692_MYCS2
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–157； UniProt 1–157 Author chain V； PDBConstruct 1–157； UniProt 1–157

Superoxide dismutase [Cu-Zn]

OrganismNot specified

UniProt A0QQQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QQQ1_MYCS2
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Y； PDBConstruct 1–236； UniProt 1–236 Author chain Z； PDBConstruct 1–236； UniProt 1–236

LpqE protein

OrganismNot specified

UniProt A0R562

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R562_MYCS2
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–186； UniProt 1–186 Author chain W； PDBConstruct 1–186； UniProt 1–186

Ubiquinol-cytochrome c reductase cytochrome b subunit

OrganismNot specified

UniProt A0R052

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R052_MYCS2
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain B； PDBConstruct 1–546； UniProt 1–546 Author chain N； PDBConstruct 1–546； UniProt 1–546

Cytochrome bc1 complex cytochrome c subunit

OrganismNot specified

UniProt I7FPH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Rieske iron-sulfur protein QcrA × 2 （I7GD61） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FPH1_MYCS2
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain C； PDBConstruct 1–294； UniProt 1–294 Author chain O； PDBConstruct 1–294； UniProt 1–294

Rieske iron-sulfur protein QcrA

OrganismNot specified

UniProt I7GD61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cytochrome c oxidase subunit 2 × 2 （A0R057） Cytochrome c oxidase subunit 1 × 2 Cytochrome c oxidase subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit CtaJ × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Prokaryotic respiratory supercomplex associate factor 1 PRSAF1 × 2 Superoxide dismutase [Cu-Zn] × 2 （A0QQQ1） LpqE protein × 2 （A0R562） Ubiquinol-cytochrome c reductase cytochrome b subunit × 2 （A0R052） Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） COPPER (II) ION × 8 HEME-A × 4 CARDIOLIPIN × 18 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 8 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 10 HEME C × 4 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7GD61_MYCS2
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A； PDBConstruct 1–421； UniProt 1–421 Author chain M； PDBConstruct 1–421； UniProt 1–421

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6adq
Deposition date deposition_date	2018-08-01
Structure title title	Respiratory Complex CIII2CIV2SOD2 from Mycobacterium smegmatis
Keywords keywords	Respiratory, Supercomplex, SOD, Mycobacterium, ETC, Lipoprotein, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6adq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6adq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6adq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.21 Å
Rg (electron density)	63.39 Å
Total Rg	63.11 Å
Atom count	48946
Residues	6026
Excluded volume	889370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6adq__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	38077.5 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,Q
Atom count atom_count	48946

MTPRGFRVVALSIVLGGSALLLSGCSWSDALALGWPTGITPEAKLNRELWIGSVIASFAVGAIVWGLIFWTSAFHRKKATDTELPRQFGYNMPLELTLTVIPFLIISVLFYFTVVVQERMMHKDPNPEVVIDVTAFQWNWKFGYQKIAFADGSFDYDGADPERKEAMTSRPEGKDEHGIEKVGPIRGMTPEDRTYLNFDKIETLGTSSEIPVLVLPAGKRIEFVLNSADVIHGFWVPEFLFKRDVLPEPKANNSDNVFQVSEIQQTGAFVGRCTEMCGTFHAMMNFEVRVVEPNDFKAYIDQRNAGKTNAEALAAINQPPLAITTEPFESRRGELVPQASK

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	64163.0 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,R

MVAEAPPIGELEARRPFPERMGPKGNLIYKLITTTDHKLIGIMYCVVCFAFFLVGGLMALFMRTELAMPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVFGFANLVLPLQIGAPDVAFPRLNALSFWLFLFGALIAIAGFITPGGAADFGWTAYSPLTDAIHSPGAGGDLWIMGLAVGGLGTILGGVNMITTVVCMRAPGMTMFRMPIFTWNILVTSILVLIAFPILTAALFGLAADRHLGAHIYDPANGGVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYATLAIAALSVAVWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWKGQLTFETPMLFSVGFLITFLLGGLSGVLLASPPLDFHVTDSYFVIAHFHYVLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDEGMPRRYADYLPTDGFTTLNVISTVGAFILGVSMLPFVWNVFKSWRYGEPVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHMVERMRAEAHVGRAHHPELETADKSS

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	22196.9 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,S

MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTARAQAGGAWPPEPTELNLALAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYEYIHLVEHGTTIPGSAYGSVFYLATGFHGLHVIGGLVAFVLLLARTKMSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFVR

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase polypeptide 4
Molecular weight formula_weight	15177.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,T

MHIEARLFEILTAFFALAAVVYAVLTAMFATGGVEWAGTTALVLTTGLTLITGTFFRFVARRLDTRPEDYEDAEISDGAGELGFFAPHSWWPILISLSFSTAAVGAALWLPWLIAAGVAFVITSVCGLVFEYYWGPEKH

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit CtaJ
Molecular weight formula_weight	8365.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,U

MSTALTHGLIGGVPLVLFAVLALIFLTRKGPHPDTYKMSDPWTHAPILWAAEEPREHGHGGHGHDSHGVVIGGGASGKW

Entity 6 Entity 6 polymer

Description description	Uncharacterized protein MSMEG_4692/MSMEI_4575
Molecular weight formula_weight	15911.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MASGDIATVANAELDLPYGSALTSSGRISAVTEPGELSVHYPFPTMDLVVLDDALKYGSRAAKARFAVYIGPLGADTAATAREILANVPTPENAVLLAVSPDQRAIEVVYGADVKGRGIESAAPLGVSAAAASFKEGNLIDGLISAVRVMSAGVSPA

Entity 7 Entity 7 polymer

Description description	Prokaryotic respiratory supercomplex associate factor 1 PRSAF1
Molecular weight formula_weight	11329.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,P

MSSTQDRSQLDPEEQPVANTEVERHTGVDVEDVPSAEWGWSHMPIGVMHIGGLLSAAFLLVMMRGNHVGHVEDWFLIGFAAVIVALVGRNWWLRRRGWIR

Entity 8 Entity 8 polymer

Description description	Superoxide dismutase [Cu-Zn]
Molecular weight formula_weight	23232.4 kDa
EC 编号 ec_number	1.15.1.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z

MLKPVSVAVLFATPVLALSACSPPGETASSEPGTTPAIWTGSPSPAAPSGEDHGGGHGAGAAGAGETLTAELKTADGTSVATADFQFADGFATVTIETTTPGRLTPGFHGVHIHSVGKCEANSVAPTGGAPGDFNSAGGHFQVSGHSGHPASGDLSSLQVRADGSGKLVTTTDAFTAEDLLDGAKTAIIIHEKADNFANIPPERYQQVNGAPGPDQTTMATGDAGSRVACGVISAG

Entity 9 Entity 9 polymer

Description description	LpqE protein
Molecular weight formula_weight	19119.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MNRFSSRAGLAVCGLATAVALTACSAGQISQTTTQEPAVNGVNAQAGQVSLRNVHLRAPQQTDYVEPGTTVELLFVAANDSTEGSNKLKSITSDVGEVTLTGDSTVPADGVLIVGEPDGQIQAVENAEAADAVTAEVELTKPITNGLLYDFTFTFEDGETTVAVPISAGEQPRRPVPPAGPGSSEH

Entity 10 Entity 10 polymer

Description description	Ubiquinol-cytochrome c reductase cytochrome b subunit
Molecular weight formula_weight	60275.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,N

MSPDFAKLAAAQGDAIDSRYHPSAAVRRQLNKVFPTHWSFLLGEIALYSFIILLLTGVWLTLFFDPSMAHVTYDGVYQPLRGVQMSRAYETALDISFEVRGGLFVRQVHHWAALMFAASIMVHLARIFFTGAFRRPREANWVIGSLLLILAMFEGFFGYSLPDDLLSGTGIRAALSGITMGIPVIGTWMHWALFGGDFPGEILIPRLYALHILLIPGIILALIGAHLALVWFQKHTQFPGPGRTETNVVGVRVMPVFAVKSGAFFAMITGVLGLMGGLLTINPIWNLGPYKPSQVSAGSQPDFYMMWTDGLIRLWPAWEFYPFGHTIPQGVWVAVGMGLVFALLIAYPFIEKKVTGDDAHHNLLQRPRDVPVRTAIGSMAIALYLLLTFACMNDIIALKFHISLNATTWIGRIGMVVLPAIVYFVAYRWAISLQRSDREVLEHGVETGIIKRLPHGAYVELHQPLGPVDEHGHPIPLEYAGAPLPKRMNKLGSGGAPGTGSFLFPDPAVEHEALTEAAHASEHKSLTALKEHQDRIHGNGETNGHH

Entity 11 Entity 11 polymer

Description description	Cytochrome bc1 complex cytochrome c subunit
Molecular weight formula_weight	30857.1 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,O

MDRAVRHHLLRPMNIGSPMSSMRRGSMTSKSRRRLRRRLSAGLLLLIGLAVAGGVAATLTPQPQVAVADESQSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGRMPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQESLIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTAMLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPEGMAMWIIGMVAAIGVAMWIGSRA

Entity 12 Entity 12 polymer

Description description	Rieske iron-sulfur protein QcrA
Molecular weight formula_weight	46383.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,M

MDYRNGGRHRCGHVDRIASMSQDSPDIKGTDAPGQTGVPGQPTDAELAEMSREELVKLGGKIDGVETIFKEPRWPVPGTKAEKRTERLVAYWLMLGGLSGLALLLVFLFWPWEYQPFGSEGEFLYSLATPLYGLTFGLSILSIGIGAVLFQKKFIPEEISVQDRHDGRSPEVHRKTVAANLTDALEGSTLKRRKVIGLSLGIGLGAFGAGTLVAFIGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRFKGETIYLARATGRPGESPFVKMRPEDIDAGGMETVFPWRESDGDGTTVESEHKLTEIAMGVRNPVMLIRIKPADMHRVIKRKGQESFNFGELFAYTKVCSHLGCPSSLYEQQTYRILCPCHQSQFDALEFAKPIFGPAARALAQLPITIDEDGYLVANGDFVEPVGPAFWERKS

Entity 13 Entity 13 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 14 Entity 14 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 15 Entity 15 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 16 Entity 16 non-polymer

Description description	(2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate
Molecular weight formula_weight	718.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 17 Entity 17 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 18 Entity 18 non-polymer

Description description	(2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate
Molecular weight formula_weight	595.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ;
Molecular weight formula_weight	853.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 20 Entity 20 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	MENAQUINONE-9
Molecular weight formula_weight	785.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 22 Entity 22 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 23 Entity 23 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	6adqB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6adqF01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6adqG01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6adqN01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6adqR01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	202215

Respiratory Complex CIII2CIV2SOD2 from Mycobacterium smegmatis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase polypeptide 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit CtaJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein MSMEG_4692/MSMEI_4575

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Superoxide dismutase [Cu-Zn]

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LpqE protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome c reductase cytochrome b subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome bc1 complex cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Rieske iron-sulfur protein QcrA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer