6hwh

Structure of a functional obligate respiratory supercomplex from Mycobacterium smegmatis

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquinol-cytochrome c reductase iron-sulfur subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R051_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–408； UniProt 1–408 Author chain B； PDBConstruct 1–408； UniProt 1–408

Cytochrome bc1 complex cytochrome c subunit

OrganismNot specified

UniProt A0R050

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R050_MYCS2
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain K； PDBConstruct 1–268； UniProt 1–268 Author chain M； PDBConstruct 1–268； UniProt 1–268 Author chain i； PDBConstruct 1–268； UniProt 1–268 Author chain j； PDBConstruct 1–268； UniProt 1–268

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt A0R057

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R057_MYCS2
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain L； PDBConstruct 1–341； UniProt 1–341 Author chain P； PDBConstruct 1–341； UniProt 1–341

MSMEG_4693

OrganismNot specified

UniProt A0R1B6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R1B6_MYCS2
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain N； PDBConstruct 1–79； UniProt 1–79 Author chain R； PDBConstruct 1–79； UniProt 1–79

Uncharacterized protein MSMEG_4692/MSMEI_4575

OrganismNot specified

UniProt A0R1B5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y4692_MYCS2
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain O； PDBConstruct 1–157； UniProt 1–157 Author chain T； PDBConstruct 1–157； UniProt 1–157

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt A0R0M4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R0M4_MYCS2
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–583； UniProt 1–583 Author chain V； PDBConstruct 1–583； UniProt 1–583

Cytochrome c oxidase polypeptide 4

OrganismNot specified

UniProt A0R056

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase subunit 3 × 2 （A0R049） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R056_MYCS2
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain S； PDBConstruct 1–139； UniProt 1–139 Author chain X； PDBConstruct 1–139； UniProt 1–139

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt A0R049

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Ubiquinol-cytochrome C reductase QcrB × 2 （I7FGS8） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R049_MYCS2
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain W； PDBConstruct 1–203； UniProt 1–203 Author chain Z； PDBConstruct 1–203； UniProt 1–203

Ubiquinol-cytochrome C reductase QcrB

Mycobacterium smegmatis MC2 155

UniProt I7FGS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 4 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 26	Ubiquinol-cytochrome c reductase iron-sulfur subunit × 2 （A0R051） Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown transmembrane helices built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Co-purified unknown peptide built as polyALA × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （A0R050） Cytochrome c oxidase subunit 2 × 2 （A0R057） MSMEG_4693 × 2 （A0R1B6） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Cytochrome c oxidase subunit 1 × 2 （A0R0M4） Cytochrome c oxidase polypeptide 4 × 2 （A0R056） Cytochrome c oxidase subunit 3 × 2 （A0R049） FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 8 MENAQUINONE-9 × 4 COPPER (II) ION × 6 HEME-AS × 4 HEME C × 1 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FGS8_MYCS2
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Y； PDBConstruct 1–546； UniProt 1–546 Author chain b； PDBConstruct 1–546； UniProt 1–546

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hwh
Deposition date deposition_date	2018-10-12
Structure title title	Structure of a functional obligate respiratory supercomplex from Mycobacterium smegmatis
Keywords keywords	Membrane Protein, Cryo-EM, Respiratory supercomplex, Mycobacterium, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hwh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hwh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hwh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.60 Å
Rg (electron density)	65.57 Å
Total Rg	65.35 Å
Atom count	40632
Residues	5304
Excluded volume	730720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hwh__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6hwh__assembly_2__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Ubiquinol-cytochrome c reductase iron-sulfur subunit
Molecular weight formula_weight	44869.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	40632

MDRIASMSQDSPDIKGTDAPGQTGVPGQPTDAELAEMSREELVKLGGKIDGVETIFKEPRWPVPGTKAEKRTERLVAYWLMLGGLSGLALLLVFLFWPWEYQPFGSEGEFLYSLATPLYGLTFGLSILSIGIGAVLFQKKFIPEEISVQDRHDGRSPEVHRKTVAANLTDALEGSTLKRRKVIGLSLGIGLGAFGAGTLVAFIGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRFKGETIYLARATGRPGESPFVKMRPEDIDAGGMETVFPWRESDGDGTTVESEHKLTEIAMGVRNPVMLIRIKPADMHRVIKRKGQESFNFGELFAYTKVCSHLGCPSSLYEQQTYRILCPCHQSQFDALEFAKPIFGPAARALAQLPITIDEDGYLVANGDFVEPVGPAFWERKS

Entity 2 Entity 2 polymer

Description description	Co-purified unknown transmembrane helices built as polyALA
Molecular weight formula_weight	6315.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,C

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 3 Entity 3 polymer

Description description	Co-purified unknown transmembrane helices built as polyALA
Molecular weight formula_weight	5549.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,D

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 4 Entity 4 polymer

Description description	Co-purified unknown peptide built as polyALA
Molecular weight formula_weight	1720.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,E

XXXXXXXXXXXXXXXXXXXX

Entity 5 Entity 5 polymer

Description description	Co-purified unknown peptide built as polyALA
Molecular weight formula_weight	2996.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,F

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 6 Entity 6 polymer

Description description	Cytochrome bc1 complex cytochrome c subunit
Molecular weight formula_weight	27874.5 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,K,i,j

MTSKSRRRLRRRLSAGLLLLIGLAVAGGVAATLTPQPQVAVADESQSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGRMPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQESLIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTAMLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPEGMAMWIIGMVAAIGVAMWIGSRA

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	38077.5 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,L

MTPRGFRVVALSIVLGGSALLLSGCSWSDALALGWPTGITPEAKLNRELWIGSVIASFAVGAIVWGLIFWTSAFHRKKATDTELPRQFGYNMPLELTLTVIPFLIISVLFYFTVVVQERMMHKDPNPEVVIDVTAFQWNWKFGYQKIAFADGSFDYDGADPERKEAMTSRPEGKDEHGIEKVGPIRGMTPEDRTYLNFDKIETLGTSSEIPVLVLPAGKRIEFVLNSADVIHGFWVPEFLFKRDVLPEPKANNSDNVFQVSEIQQTGAFVGRCTEMCGTFHAMMNFEVRVVEPNDFKAYIDQRNAGKTNAEALAAINQPPLAITTEPFESRRGELVPQASK

Entity 8 Entity 8 polymer

Description description	MSMEG_4693
Molecular weight formula_weight	8365.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,N

MSTALTHGLIGGVPLVLFAVLALIFLTRKGPHPDTYKMSDPWTHAPILWAAEEPREHGHGGHGHDSHGVVIGGGASGKW

Entity 9 Entity 9 polymer

Description description	Uncharacterized protein MSMEG_4692/MSMEI_4575
Molecular weight formula_weight	15911.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,O

MASGDIATVANAELDLPYGSALTSSGRISAVTEPGELSVHYPFPTMDLVVLDDALKYGSRAAKARFAVYIGPLGADTAATAREILANVPTPENAVLLAVSPDQRAIEVVYGADVKGRGIESAAPLGVSAAAASFKEGNLIDGLISAVRVMSAGVSPA

Entity 10 Entity 10 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	64841.6 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,Q

MTTHAPSAGELLARRPFPQRLGPRWTLLYKLVTTTDHKLIGMMYVVACFIFFFIGGLMALLLRTELAVPGLQFLSNEQYNQLFTMHGTVMLLFYATPIVFGFANLVVPLQIGAPDVAFPRLNALSFWLFLFGASIALGGFLAPGGPADFGWTAYTPLSNAMHSPGAGGDLWIFGLIVGGLGTILGAVNMITTVVCMRAPGMIMFRMPIFTWNILVTSVIVLVAFPLLTSALFGLAADRNLGAHVFDPANGGTMLWEHLFWFFGHPEVYIIALPFFGIVTEIFPVFSRKPVFGYTTLVYATISIGALSIAVWAHHLYATGAVLLPFFSFMTFMIAVPTGIKFVNWIGTMWKGQLTFETPMLFSVGFLVTFLLGGLTGVILASPPLDFHVTDSYFVVAHFHYVLFGTIVFATYAGVYFWFPKMTGRLLDDRLGKLHFWLTLIGFHTTFLVHHWLGAEGMPRRYADYLPTDGFTTLNIVSTIGSFILGVSMLPFVWNVFKSWRYGEPVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHMIERLRAESHPGRTQGGPGAVTLPQPQARSHPVE

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase polypeptide 4
Molecular weight formula_weight	15177.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,S

MHIEARLFEILTAFFALAAVVYAVLTAMFATGGVEWAGTTALVLTTGLTLITGTFFRFVARRLDTRPEDYEDAEISDGAGELGFFAPHSWWPILISLSFSTAAVGAALWLPWLIAAGVAFVITSVCGLVFEYYWGPEKH

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	22196.9 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,W

MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTARAQAGGAWPPEPTELNLALAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYEYIHLVEHGTTIPGSAYGSVFYLATGFHGLHVIGGLVAFVLLLARTKMSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFVR

Entity 13 Entity 13 polymer

Description description	Ubiquinol-cytochrome C reductase QcrB
Molecular weight formula_weight	61271.9 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,Y

MSPDFAKLAAAQGDAIDSRYHPSAAVRRQLNKVFPTHWSFLLGEIALYSFIILLLTGVWLTLFFDPSMAHVTYDGVYQPLRGVQMSRAYETALDISFEVRGGLFVRQVHHWAALMFAASIMVHLARIFFTGAFRRPREANWVIGSLLLILAMFEGFFGYSLPDDLLSGTGIRAALSGITMGIPVIGTWMHWALFGGDFPGEILIPRLYALHILLIPGIILALIGAHLALVWFQKHTQFPGPGRTETNVVGVRVMPVFAVKSGAFFAMITGVLGLMGGLLTINPIWNLGPYKPSQVSAGSQPDFYMMWTDGLIRLWPAWEFYPFGHTIPQGVWVAVGMGLVFALLIAYPFIEKKVTGDDAHHNLLQRPRDVPVRTAIGSMAIALYLLLTFACMNDIIALKFHISLNATTWIGRIGMVVLPAIVYFVAYRWAISLQRSDREVLEHGVETGIIKRLPHGAYVELHQPLGPVDEHGHPIPLEYAGAPLPKRMNKLGSGGAPGTGSFLFPDPAVEHEALTEAAHASEHKSLTALKEHQDRIHGNGETNGHHDYKDDDDK

Source Source

Source organism organism	Mycobacterium smegmatis MC2 155
NCBI taxonomy ID ncbi_taxonomy_id	246196
Host organism host_organism	Mycobacterium smegmatis MC2 155

Entity 14 Entity 14 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 16 Entity 16 non-polymer

Description description	MENAQUINONE-9
Molecular weight formula_weight	785.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 18 Entity 18 non-polymer

Description description	HEME-AS
Molecular weight formula_weight	921.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 20 Entity 20 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	6hwhQ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6hwhV01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	6hwhW01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6hwhY01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	6hwhZ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6hwhb01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	104198

Structure of a functional obligate respiratory supercomplex from Mycobacterium smegmatis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquinol-cytochrome c reductase iron-sulfur subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome bc1 complex cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MSMEG_4693

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein MSMEG_4692/MSMEI_4575

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase polypeptide 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase QcrB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hwh__assembly_1__model_1

6hwh__assembly_1__model_1 | I(q)

6hwh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment