9dm1

Mycobacterial supercomplex malate:quinone oxidoreductase assembly

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0K0XH24_MYCGD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain L； PDBConstruct 1–566； UniProt 10–575 Author chain R； PDBConstruct 1–566； UniProt 10–575

Cytochrome bc1 complex cytochrome b subunit

OrganismNot specified

UniProt I7FGS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FGS8_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–535； UniProt 4–538 Author chain F； PDBConstruct 1–535； UniProt 4–538

Superoxide dismutase [Cu-Zn]

OrganismNot specified

UniProt I7G2H6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7G2H6_MYCS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–216； UniProt 21–236 Author chain G； PDBConstruct 1–216； UniProt 21–236

Cytochrome aa3 subunit 2

OrganismNot specified

UniProt I7GD63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7GD63_MYCS2
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–312； UniProt 27–338 Author chain Q； PDBConstruct 1–312； UniProt 27–338

Cytochrome aa3 subunit 3

OrganismNot specified

UniProt A0R049

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0R049_MYCS2
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain S； PDBConstruct 1–203； UniProt 1–203 Author chain X； PDBConstruct 1–203； UniProt 1–203

Cytochrome c oxidase polypeptide 4

OrganismNot specified

UniProt I7FPH7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FPH7_MYCS2
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain T； PDBConstruct 1–139； UniProt 1–139 Author chain Z； PDBConstruct 1–139； UniProt 1–139

Cytochrome c oxidase subunit CtaJ

OrganismNot specified

UniProt I7FQK8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FQK8_MYCS2
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain U； PDBConstruct 1–79； UniProt 1–79 Author chain a； PDBConstruct 1–79； UniProt 1–79

Uncharacterized protein MSMEG_4692/MSMEI_4575

OrganismNot specified

UniProt A0R1B5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y4692_MYCS2
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain V； PDBConstruct 1–145； UniProt 13–157 Author chain b； PDBConstruct 1–145； UniProt 13–157

Cytochrome bc1 complex cytochrome c subunit

OrganismNot specified

UniProt I7FPH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FPH1_MYCS2
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–223； UniProt 72–294 Author chain O； PDBConstruct 1–223； UniProt 72–294

LpqE protein

OrganismNot specified

UniProt I7GFE1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7GFE1_MYCS2
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain W； PDBConstruct 1–159； UniProt 24–182 Author chain c； PDBConstruct 1–159； UniProt 24–182

Cytochrome bc1 complex Rieske iron-sulfur subunit

OrganismNot specified

UniProt I7GD61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Probable malate:quinone oxidoreductase × 1 （A0QVL2） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7GD61_MYCS2
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–382； UniProt 40–421 Author chain Y； PDBConstruct 1–382； UniProt 40–421

Probable malate:quinone oxidoreductase

OrganismNot specified

UniProt A0QVL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 25	Cytochrome c oxidase subunit 1 × 2 （A0A0K0XH24） Cytochrome bc1 complex cytochrome b subunit × 2 （I7FGS8） Superoxide dismutase [Cu-Zn] × 2 （I7G2H6） Cytochrome aa3 subunit 2 × 2 （I7GD63） Cytochrome aa3 subunit 3 × 2 （A0R049） Cytochrome c oxidase polypeptide 4 × 2 （I7FPH7） Cytochrome c oxidase subunit CtaJ × 2 （I7FQK8） Uncharacterized protein MSMEG_4692/MSMEI_4575 × 2 （A0R1B5） Conserved transmembrane protein × 2 Cytochrome bc1 complex cytochrome c subunit × 2 （I7FPH1） LpqE protein × 2 （I7GFE1） Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （I7GD61） COPPER (II) ION × 6 HEME-A × 4 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 MENAQUINONE-9 × 8 (2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate × 6 PALMITIC ACID × 4 (2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate × 4 HEME C × 4 ;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ; × 8 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MQO_MYCS2
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A； PDBConstruct 1–510； UniProt 1–510

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9dm1
Deposition date deposition_date	2024-09-11
Structure title title	Mycobacterial supercomplex malate:quinone oxidoreductase assembly
Keywords keywords	Electron transport chain, mycobacterial CIII2CIV2 supercomplex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9dm1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9dm1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9dm1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.64 Å
Rg (electron density)	64.51 Å
Total Rg	64.20 Å
Atom count	51339
Residues	6557
Excluded volume	925990 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9dm1__assembly_1__model_1`	25-meric （25）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (24)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	63296.9 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,L
Atom count atom_count	51339

ELEARRPFPERMGPKGNLIYKLITTTDHKLIGIMYCVVCFAFFLVGGLMALFMRTELAMPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVFGFANLVLPLQIGAPDVAFPRLNALSFWLFLFGALIAIAGFITPGGAADFGWTAYSPLTDAIHSPGAGGDLWIMGLAVGGLGTILGGVNMITTVVCMRAPGMTMFRMPIFTWNILVTSILVLIAFPILTAALFGLAADRHLGAHIYDPANGGVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYATLAIAALSVAVWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWKGQLTFETPMLFSVGFLITFLLGGLSGVLLASPPLDFHVTDSYFVIAHFHYVLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDEGMPRRYADYLPTDGFTTLNVISTVGAFILGVSMLPFVWNVFKSWRYGEPVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHMVERMRAEAHVGRAHHPELETADKSS

Entity 2 Entity 2 polymer

Description description	Cytochrome bc1 complex cytochrome b subunit
Molecular weight formula_weight	59110.8 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

DFAKLAAAQGDAIDSRYHPSAAVRRQLNKVFPTHWSFLLGEIALYSFIILLLTGVWLTLFFDPSMAHVTYDGVYQPLRGVQMSRAYETALDISFEVRGGLFVRQVHHWAALMFAASIMVHLARIFFTGAFRRPREANWVIGSLLLILAMFEGFFGYSLPDDLLSGTGIRAALSGITMGIPVIGTWMHWALFGGDFPGEILIPRLYALHILLIPGIILALIGAHLALVWFQKHTQFPGPGRTETNVVGVRVMPVFAVKSGAFFAMITGVLGLMGGLLTINPIWNLGPYKPSQVSAGSQPDFYMMWTDGLIRLWPAWEFYPFGHTIPQGVWVAVGMGLVFALLIAYPFIEKKVTGDDAHHNLLQRPRDVPVRTAIGSMAIALYLLLTFACMNDIIALKFHISLNATTWIGRIGMVVLPAIVYFVAYRWAISLQRSDREVLEHGVETGIIKRLPHGAYVELHQPLGPVDEHGHPIPLEYAGAPLPKRMNKLGSGGAPGTGSFLFPDPAVEHEALTEAAHASEHKSLTALKEHQDRIHG

Entity 3 Entity 3 polymer

Description description	Superoxide dismutase [Cu-Zn]
Molecular weight formula_weight	21221.9 kDa
EC 编号 ec_number	1.15.1.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,G

CSPPGETASSEPGTTPAIWTGSPSPAAPSGEDHGGGHGAGAAGAGETLTAELKTADGTSVATADFQFADGFATVTIETTTPGRLTPGFHGVHIHSVGKCEANSVAPTGGAPGDFNSAGGHFQVSGHSGHPASGDLSSLQVRADGSGKLVTTTDAFTAEDLLDGAKTAIIIHEKADNFANIPPERYQQVNGAPGPDQTTMATGDAGSRVACGVISAG

Entity 4 Entity 4 polymer

Description description	Cytochrome aa3 subunit 2
Molecular weight formula_weight	35201.0 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,K

WSDALALGWPTGITPEAKLNRELWIGSVIASFAVGAIVWGLIFWTSAFHRKKATDTELPRQFGYNMPLELTLTVIPFLIISVLFYFTVVVQERMMHKDPNPEVVIDVTAFQWNWKFGYQKIAFADGSFDYDGADPERKEAMTSRPEGKDEHGIEKVGPIRGMTPEDRTYLNFDKIETLGTSSEIPVLVLPAGKRIEFVLNSADVIHGFWVPEFLFKRDVLPEPKANNSDNVFQVSEIQQTGAFVGRCTEMCGTFHAMMNFEVRVVEPNDFKAYIDQRNAGKTNAEALAAINQPPLAITTEPFESRRGELVPQ

Entity 5 Entity 5 polymer

Description description	Cytochrome aa3 subunit 3
Molecular weight formula_weight	22196.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,X

MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTARAQAGGAWPPEPTELNLALAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYEYIHLVEHGTTIPGSAYGSVFYLATGFHGLHVIGGLVAFVLLLARTKMSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFVR

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase polypeptide 4
Molecular weight formula_weight	15177.4 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,Z

MHIEARLFEILTAFFALAAVVYAVLTAMFATGGVEWAGTTALVLTTGLTLITGTFFRFVARRLDTRPEDYEDAEISDGAGELGFFAPHSWWPILISLSFSTAAVGAALWLPWLIAAGVAFVITSVCGLVFEYYWGPEKH

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit CtaJ
Molecular weight formula_weight	8365.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,a

MSTALTHGLIGGVPLVLFAVLALIFLTRKGPHPDTYKMSDPWTHAPILWAAEEPREHGHGGHGHDSHGVVIGGGASGKW

Entity 8 Entity 8 polymer

Description description	Uncharacterized protein MSMEG_4692/MSMEI_4575
Molecular weight formula_weight	14808.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,b

ELDLPYGSALTSSGRISAVTEPGELSVHYPFPTMDLVVLDDALKYGSRAAKARFAVYIGPLGADTAATAREILANVPTPENAVLLAVSPDQRAIEVVYGADVKGRGIESAAPLGVSAAAASFKEGNLIDGLISAVRVMSAGVSPA

Entity 9 Entity 9 polymer

Description description	Conserved transmembrane protein
Molecular weight formula_weight	11329.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,J

MSSTQDRSQLDPEEQPVANTEVERHTGVDVEDVPSAEWGWSHMPIGVMHIGGLLSAAFLLVMMRGNHVGHVEDWFLIGFAAVIVALVGRNWWLRRRGWIR

Entity 10 Entity 10 polymer

Description description	Cytochrome bc1 complex cytochrome c subunit
Molecular weight formula_weight	23184.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,I

QSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGRMPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQESLIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTAMLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPEGMAMWIIGMVAAIGVAMWIGSRA

Entity 11 Entity 11 polymer

Description description	LpqE protein
Molecular weight formula_weight	16412.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,W

CSAGQISQTTTQEPAVNGVNAQAGQVSLRNVHLRAPQQTDYVEPGTTVELLFVAANDSTEGSNKLKSITSDVGEVTLTGDSTVPADGVLIVGEPDGQIQAVENAEAADAVTAEVELTKPITNGLLYDFTFTFEDGETTVAVPISAGEQPRRPVPPAGPG

Entity 12 Entity 12 polymer

Description description	Cytochrome bc1 complex Rieske iron-sulfur subunit
Molecular weight formula_weight	42210.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,M

GQPTDAELAEMSREELVKLGGKIDGVETIFKEPRWPVPGTKAEKRTERLVAYWLMLGGLSGLALLLVFLFWPWEYQPFGSEGEFLYSLATPLYGLTFGLSILSIGIGAVLFQKKFIPEEISVQDRHDGRSPEVHRKTVAANLTDALEGSTLKRRKVIGLSLGIGLGAFGAGTLVAFIGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRFKGETIYLARATGRPGESPFVKMRPEDIDAGGMETVFPWRESDGDGTTVESEHKLTEIAMGVRNPVMLIRIKPADMHRVIKRKGQESFNFGELFAYTKVCSHLGCPSSLYEQQTYRILCPCHQSQFDALEFAKPIFGPAARALAQLPITIDEDGYLVANGDFVEPVGPAFWERKS

Entity 13 Entity 13 polymer

Description description	Probable malate:quinone oxidoreductase
Molecular weight formula_weight	54970.4 kDa
EC 编号 ec_number	1.1.5.4
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSEANAGTNAKTDVVLVGAGIMSATLGTLIKLLEPNWSITMIERLDGAAAESSDPWNNAGTGHSALCELNYTPALPDGTIDISKAVNVNEQFQVSRQFWAHAVENGVLPDVRSFLNPVPHVSFVYGADNVQYLKARYNALVTNPLFASMEFIDDKDEFTRRLPLMAEKRDFSEPVALNWSQHGTDVDFGSLSRQLIGFAAGNGMTTMFGHDVRDLSKNSDGSWTVKVRNRRTGNNFKINAKFVFVGAGGGALPLLQKSGIPEAKGFGGFPVGGAFLRTNKQHLTSRHNAKVYGLPPLGAPPMSVPHLDTRVINGRQWLLFGPFAGWSPKFLKQGKVTDLPLSVKPNNLASMLGVGLTEVGLLKYLIGQLLLSEPARVETLREFAPSAVDSDWELDIAGQRVQVIRRKGAGGVLEFGTTVLAAADGSIAGLLGASPGASTAVPAMLDVLQRCFADRYQAWTPKLKEMVPSLGTKLSDEPKLFEEVWSWGTKVLKLDVQANTAEAANAPATV

Entity 14 Entity 14 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 15 Entity 15 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 16 Entity 16 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 17 Entity 17 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 18 Entity 18 non-polymer

Description description	MENAQUINONE-9
Molecular weight formula_weight	785.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 19 Entity 19 non-polymer

Description description	(2R)-3-(((2-aminoethoxy)(hydroxy)phosphoryl)oxy)-2-(palmitoyloxy)propyl (E)-octadec-9-enoate
Molecular weight formula_weight	718.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 20 Entity 20 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	(2S)-1-(hexadecanoyloxy)propan-2-yl (10S)-10-methyloctadecanoate
Molecular weight formula_weight	595.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 22 Entity 22 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 23 Entity 23 non-polymer

Description description	;(2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate ;
Molecular weight formula_weight	853.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 24 Entity 24 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	145585

Mycobacterial supercomplex malate:quinone oxidoreductase assembly

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome bc1 complex cytochrome b subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Superoxide dismutase [Cu-Zn]

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome aa3 subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome aa3 subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase polypeptide 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit CtaJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein MSMEG_4692/MSMEI_4575

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome bc1 complex cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LpqE protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer