6cfz

Structure of the DASH/Dam1 complex shows its role at the yeast kinetochore-microtubule interface

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ask1

Chaetomium thermophilum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S8F9_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–77； UniProt 13–88

Dad3

Chaetomium thermophilum

UniProt G0RY74

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RY74_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–67； UniProt 18–83

Dad2

Chaetomium thermophilum

UniProt G0RZB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZB3_CHATD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 2–94； UniProt 25–117

Duo1

Chaetomium thermophilum

UniProt G0SAN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SAN7_CHATD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 2–111； UniProt 49–158

Dad4

Chaetomium thermophilum

UniProt G0S589

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S589_CHATD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–63； UniProt 1–63

Dad1,Dad1

Chaetomium thermophilum

UniProt G0RYE9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYE9_CHATD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–57； UniProt 17–73

Dam1

Chaetomium thermophilum

UniProt G0S2K4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Spc19 × 17 （G0S0N0） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Spc19 × 1 （G0S0N0） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S2K4_CHATD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 2–56； UniProt 53–107

Spc19

Chaetomium thermophilum

UniProt G0S0N0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc34 × 17 （G0S2A3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc34 × 1 （G0S2A3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc34 × 1 （G0S2A3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S0N0_CHATD
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 2–151； UniProt 7–156

Spc34

Chaetomium thermophilum

UniProt G0S2A3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 170	Ask1 × 17 （G0S8F9） Dad3 × 17 （G0RY74） Dad2 × 17 （G0RZB3） Duo1 × 17 （G0SAN7） Dad4 × 17 （G0S589） Dad1,Dad1 × 17 （G0RYE9） Hsk3 × 17 Dam1 × 17 （G0S2K4） Spc19 × 17 （G0S0N0）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 10	Ask1 × 1 （G0S8F9） Dad3 × 1 （G0RY74） Dad2 × 1 （G0RZB3） Duo1 × 1 （G0SAN7） Dad4 × 1 （G0S589） Dad1,Dad1 × 1 （G0RYE9） Hsk3 × 1 Dam1 × 1 （G0S2K4） Spc19 × 1 （G0S0N0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S2A3_CHATD
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–239； UniProt 1–239

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6cfz
Deposition date deposition_date	2018-02-19
Structure title title	Structure of the DASH/Dam1 complex shows its role at the yeast kinetochore-microtubule interface
Keywords keywords	;DASH, Dam1 complex, Ask1, Dad1, Dad2, Dad3, Dad4, Dam1, Duo1, Hsk3, Spc19, Spc34, kinetochore, kinetochore-microtubule interface, chromosome segregation, cell-division, point-centromere yeast, NUCLEAR PROTEIN ;; NUCLEAR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6cfz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6cfz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6cfz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	238.90 Å
Total Rg	239.00 Å
Atom count	204102
Residues	12937
Excluded volume	1815200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6cfz__assembly_1__model_1`	170-meric （170）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6cfz__assembly_2__model_1`	decameric （10）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`6cfz__assembly_3__model_1`	decameric （10）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Ask1
Molecular weight formula_weight	8897.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12006

MTLTEELEKLEQQITLTLQEIDSNFAKAHRIVTTSILPLVEQYGEHSRAVWEATKFWKQFFEASANVSLSGYEELVD

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Dad3
Molecular weight formula_weight	7599.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLSPLEQEVLDEYERLSENMKKLAVLLDELASAPATEILDGLRELERKTSLVFTLLKASVYSIVLQQ

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Dad2
Molecular weight formula_weight	10229.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSPALLARVNEKKAELENLKELRDLSAAVAAQMEALEQKLSTLSSGTEAIATVLANWHNVLRAISMASAKIPEPKEETEENTVPLPQTLVRIPT

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Duo1
Molecular weight formula_weight	12907.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MEAREAALRKELEGVRKINEVIEGMIGTLERAKGNMGTVSQTVTNATTLLNTWTRMLSQTEHNQRLILNPEWKGATQDLLELEAEERRRQEEVERRAAEAERRREEARRKA

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Dad4
Molecular weight formula_weight	8400.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MESPHEHQQNLLLSRIITNVEKLNEAIMVMNKTLQEINIQNMNIELVAQMFKNYQSNVLFHLEATDNLKDPA

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Dad1,Dad1
Molecular weight formula_weight	10684.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSYFEQQRQALIEEIAMNFEHVLANINKLNRSLEAVIAVGNEFSSVEALWSQFENVMSWSHPQFEKGAMTGWSHPQFEKRSAGSWSHPQFEK

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Hsk3
Molecular weight formula_weight	6641.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAVKARQLAHLHSQLTQLSHNLATTENLMRMTAVQAEAMRGLGSWHAGLFMAASKVLGEES

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Dam1
Molecular weight formula_weight	6314.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MNAFEPAFAELADAVADLEANMMHFQLMHESLARFSESFASFLYGLNMNAFCVDFP

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	Spc19
Molecular weight formula_weight	17028.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSYADCVCSLRTSLAFLESSVATLDNGVQDFPRLCHVLRTVRHYELIPQTTLAAAEASLRDEIGPFIQLLLDRAEKHLDRQARRIETLKARAELNAGRLSQYSGDGHNNGKFSGQGMDFRKSRPLNGEAALRAKVVRQRKEALKYSVERLE

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Spc34
Molecular weight formula_weight	27443.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSLLSAHLEQISISCQGIDSLPFPPPKIFTNALLSNPDITSLIRDTEAHERALFSVPPPPPRQTTLTAEQQQQQKPSNRRQTVFNVTGGEIRTGGVGSASTARRNTAVAAVLGGDLHAQIMRGTRARPGQQPGSGDIDMEVLLRGVEKLCAVYPLPGALERVPVIRQKWQAQSNTLAYYEAKIAEQQEMLDRIAQERMMNDGDGDVEMEDVEEVGMTEEDLRREEEEVRELDKRKRDLQHHHHHH

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	34997

Structure of the DASH/Dam1 complex shows its role at the yeast kinetochore-microtubule interface

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ask1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dad3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dad2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Duo1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dad4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dad1,Dad1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dam1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spc19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spc34

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6cfz__assembly_1__model_1

6cfz__assembly_1__model_1 | I(q)

6cfz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment