6fml

CryoEM Structure INO80core Nucleosome complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RuvB-like helicase

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYI5_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–462； UniProt 1–462 Author chain B； PDBConstruct 1–462； UniProt 1–462 Author chain C； PDBConstruct 1–462； UniProt 1–462

RuvB-like helicase

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0RYC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYC2_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–488； UniProt 1–488 Author chain E； PDBConstruct 1–488； UniProt 1–488 Author chain F； PDBConstruct 1–488； UniProt 1–488

les2

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0RY01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RY01_CHATD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–382； UniProt 1–382 Author chain H； PDBConstruct 414–491； UniProt 415–492

Ies6

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S590

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S590_CHATD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–219； UniProt 1–219

Actin related protein 5

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S589

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S589_CHATD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–470； UniProt 98–567 Author chain J； PDBConstruct 521–571； UniProt 617–667 Author chain J； PDBConstruct 587–770； UniProt 683–866

Histone H3.2

Homo sapiens

UniProt Q71DI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H32_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–135； UniProt 2–136 Author chain Q； PDBConstruct 1–135； UniProt 2–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H2A type 1 × 2 （P0C0S9） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–102； UniProt 2–103 Author chain R； PDBConstruct 1–102； UniProt 2–103

Histone H2A type 1

Homo sapiens

UniProt P0C0S9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2B type 1-C/E/F/G/I × 2 （P62807） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–129； UniProt 2–130 Author chain S； PDBConstruct 1–129； UniProt 2–130

Histone H2B type 1-C/E/F/G/I

Homo sapiens

UniProt P62807

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	RuvB-like helicase × 3 （G0RYI5） RuvB-like helicase × 3 （G0RYC2） Ino80 × 1 les2 × 1 （G0RY01） Ies6 × 1 （G0S590） Actin related protein 5 × 1 （G0S589） Nucleosomal DNA Strand 1 × 1 Nucleosomal DNA Strand 2 × 1 Histone H3.2 × 2 （Q71DI3） Histone H4 × 2 （P62805） Histone H2A type 1 × 2 （P0C0S9） ADENOSINE-5'-DIPHOSPHATE × 6 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1C_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–125； UniProt 2–126 Author chain T； PDBConstruct 1–125； UniProt 2–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6fml
Deposition date deposition_date	2018-01-31
Structure title title	CryoEM Structure INO80core Nucleosome complex
Keywords keywords	INO80, Nucleosome, ATP dependent Chromatin Remodeller, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6fml__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6fml__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6fml__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.76 Å
Rg (electron density)	62.47 Å
Total Rg	62.69 Å
Atom count	43460
Residues	5114
Excluded volume	754480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6fml__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	RuvB-like helicase
Molecular weight formula_weight	50451.8 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	43460

MVQISEVRGNTRDHRTAAHTHIKGLGLNSSGIAEKQAAGFVGQCAAREACGVVVDLIKAHKMAGRGVLLAGGPGTGKTALALAISQELGTKIPFCPITGSEIYSTEVKKTEVLMENFRRAIGLRVRETKDVYEGEVTEMTPEEAENPLGGYGKTISTLLIGLKSARGQKKLRLDPSIYEAIQKERVQVGDVIYIETNTGACKRVGRSDAYATEFDLEAEEYVPIPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDIISMMGQLMKPKMTEITDKLRMEINKVVQKYINQGVAELIPGVLFIDEAHMLDIECFTYLNKALESPIAPIVVLASNRGIATIRGADDLKAAHGIPPDFLQRLLIIPTHPYEPDEIRRIVRIRAQTEGVQLTDAAVDRVAEHGVRISLRYCLQLLAPASILARVNGRTQVDVQDIAEAEELFLDARRSANILTSTGESGGLHGFIS

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	RuvB-like helicase
Molecular weight formula_weight	53212.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MAAPLVTSVTETKELRGLNLIAAHSHIRGLGVDADTLEPRPSSQGLVGQEKARKAAAVVLEMIKQGKIAGRAVLIAGPPSTGKTAIAMGMAQSLGQDVPFTTLAASEIFSLEMSKTEALTQAFRKSIGVRIKEESEIMEGEVVEIQIDRSVTGGAKQGKLTIKTTDMEAIYDMGSKMIDAMTKERVMAGDIISIDKSSGKITKLGRSYARSRDYDAMGVDTKFLQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEIRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSYINRALESDLAPIVIMASNRGVSRIRGTDYKSPHGLPLDFLDRVVIINTHPYTPDELRQILSIRAQEEEVDLTPDALALLTKIGQEAGLRYASNLITTSQLIAAKRRAKQVGVEDVQRSFKLFYDPARSVRFVQESEKRLIGNDGVVDFSYQGAAEAAAPTLPAAAPVDPVGGEKMDMS

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Ino80
Molecular weight formula_weight	210443.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDHFPTVLQRPPHFDEDGSAGTGRMRSNVVGNGSSNGARDDRGLRGGLRDILNPVGSASQTMPSASHGGTHSTPGTPGAPAPPRPHSSFSLRSPTQTGNHHASPYSAPTSSAAATSSQQPAGACSMLNNPFVTASTPFPPPPLQAPPSLASSRTSPSGLQHPPRSPLHAPPVYYPSDVRDRDLVRDQQTSLSFYDPTTDSKRDRDRERDRERERTGSDPESGAWSTSTQNSPPKIRDSYNYSRSPSFNNSGNYPSATGSYPPRSPVVRPHPAPPAGSMSPSAGSRTVTSPSLRHLAMPSTHSSQSASTVLPPLARTETPAPSARATPASNTPSRASGVMSFSNILSSSEPISKPRPTSPISLDNNPAMVARTEPAERPDKGEKDKKQSRKIIKTRVSDIKSAESTPKMTRKSAVKPETPTMLRIPTKRTANGSMKHKAFSADKEKTIRDIMDQFDYESIDETEFEDELLAWKERARRRRQEMNRRDFIHRQSRRSDFAETEALKLQIHANLGKARYSDLHYDEALQEVREQELWAEKERKKDMQRKRRREKSMAATLEQQAAALQKASQAEDEAERLKYIREAERANKKVQQTKYILQKGIKGPARNLPPIEPNLEGGTMATFSAENMEPGKVKGKGRGGRLKKSKEQKQAEKEQAELAQAAIDAGEEPPSKEETKIRIKLSKAKASAKEEAEKDKENKEPKQPKEPEKPVEEPKDPLELKFQSKGYNQIYDQIWRDLARKDVSKVFRLATDSYATKASNLKKTAILASKEAKRWQLRTNKGTKDLQARAKRVMRDMMGFWKRNEREERDLRKAAERLELENARKEEADREAARQRRKLNFLISQTELYSHFISKKIKTHEVERSTDHPDVATDEKDKIPEPTLNINVPEPTGPIAPKVTDFNSLDFDNEDESALQAAAMANAQNAIAEAQKKAREFNKDETKLDEDGEMNFQHPELTEFEVAQPKLLNCQLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTVQSISVMAYLAERYDIWGPFLVVAPASTLHNWQQEVSKFVPDFKVLPYWGTAADRKVLRKFWDRKHTTYKKDSPFHVMITSYQLVVSDVAYFQKMKWQYMILDEAQAIKSSQSSRWKCLLGFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSHDEFSEWFSKDIESHAQSNTKLNEDQLKRLHMILKPFMLRRVKKHVQKELGDKIEIDVFCELSYRQRAMYQSLRNQISIMDLIEKATVGDNEDSATLMNLVMQFRKVCNHPDLFERADTSSPFFCGHFAETGSFLREGTNVALGYSTRSLVEYRLPRLIWCDGGRLDKPGPGNLVAGFRSKYLNHMMNIWTPENIRSSLEGIENFTWLRFVDTSLQEAYRASHTDVFARAVDLASKQNRLGHMQIVYDEPEDKKWTPVHALFQICERENPKAVAEITTEGVLRDLMNIARVKYRELGLCRLEKAARPRASAPPIEVVCDSRSAVIERENIMFHPAMRKALFGPTPSEIKEASFGPRPVTLYPPRALLPAPDHDKQRFTNITVPSMARFVTDSGKLAKLDELLRELKEGGHRVLLYFQMTRMIDLMEEYLTYRNYKYCRLDGSTKLEDRRDTVADFQTRPEIFIFLLSTRAGGLGINLTTADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLITRGTIEERIRKRALQKEEVQRVVITGTGSVDFSGRRPPENRNRDIAMWLADDEQAEMIERREKELIESGEYDKIMQQRRKGGKRKRGAANGDTVPSLEDMYHEGEGHFDDNKGSGAATPVDADSLGRGGKRKKAGGSKKAKTTKQRLAIADGEIDDGEIDIDYKDDDDKGTDYKDDDDK

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	les2
Molecular weight formula_weight	52018.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSTRPRRHAAQRASQAITDLADRDRESDHSHGPISSRMSSFNSSSRSRLPGKGIASVSRSEAGGASDPEHIHLTVKLPSSKLRQATSSSGIKKAGSVGSSSSSSGGGKAAVKRARGGKRSRVLESSEEEEEENEVEVLGDEDEEEEEEEDEIEVREGEGYDEDEEDVEDEDEEMQDLGEEDADGEDDEMDVDAEGEEDADGDVNMDAGVVGARATTVRAVPPAIKVTKPPKESPSNGKAATASKANDNAVPVKRPAPDSDDESLSSLESEPEEEVNVAGGEDAEGEDDDAEGEVDAEGEEEEEEEEIEVADEDAEGEDVEQDEDEDEEEEDDDDEMISRAQTPDMSRLTARQRARLGEASGEYLKLSDEVQSKKHFTAEELSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQAPRTTRRAAQAAAAAEEAEEAAKQPKRPDPMMIRWVNNKMGSVVAVPEELLGTHAGVVFGAGPGKGLPAGKMVEEVS

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Ies6
Molecular weight formula_weight	23127.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSNPDAQSAQAAHQALVEQLDLHSIHKTFRNPNWRPNQRRNKTIKAILGESQRKEASSTSAVATPRADDNGGGSGADTPANNDNNDGLSTSGTSTPANGNGSGAGTPASNGQPNLAQASRSLQKLVLEKSLASAQAPDKKAANGFASSAPTATYTNIESAPSLAPMKHYCDVTGLPAPYLDPKTRLRYHNKEIFAMIRNLPQGMGEQFLEARGAHTVLK

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Actin related protein 5
Molecular weight formula_weight	85996.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAPSAVAEPPPIPQRDEPWKRLPPPTVYPVKEARFEKYIPPQLDGRERALAQPPGQVAIVIDNGSHSVRAGWNFEDKPRLAIPPIMSKYRDRKMGKTFSFAGSDCYADTTARSHIRNAFEAGTGIVSNWDVMEHVLDYVFVKLGMNECDGAIDMPIVMTEAVANLPYSRKSMSEIIFECYGAPSLVYGIDSLFSFRHNQGQTGLVVSSSYSATHVIPVYNRKALLSQAIRLNWGGWHMAEYMLKLLKLKYYTGFPGKLNSSQTEHMVRDFCYVSLDYDRELAGYLDWTGLEDRERIVQYPYTEEVVVQKTEEELARIAERKKESGRRLQEQAAKMRLERLMKKEQELEYYKDIQRRMQGESKKEIKRLLDEAELKDEAALERVIRDLERSIKRARQKDLGEPEEEEVPDFSLLDVPDDQLDEAGLRQKRQQRLLKSNWEARQRAKAEKEAEKARLAEEARLDEERRKNDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNRKSXXXXXXXXXXXXXXXXXNPTGSGSRKRRRGGAGADQDDDFGADDADWGVYRSVAIGANKGDDSDDEEGXXXXXXXXXXXXXXXLRYDKTFSYDMTLDAQRDWSKSLLHAFRYGPRPFDPSSQAETHRVHLNVERIRVPEVLFQPAAIAGVDQAGLVEIAGDILCQRLPSLPGIQDAPDAFLRDVFLTGGNTLFQNFDERLRQGLMALLPVGAPLRVRRAQDAILDAWRGAAGWACTEEAKAAWITREEYLEKGGEYIKEHDLGNAFA

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Nucleosomal DNA Strand 1
Molecular weight formula_weight	60652.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	K

CTCGGAACACTATCCGACTGGCACCGGCAAGGTCGCTGTTCAATACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTTGCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCA

Entity 8 Entity 8 polymer

Description description	Nucleosomal DNA Strand 2
Molecular weight formula_weight	60376.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	L

TGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGCAAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCATGTATTGAACAGCGACCTTGCCGGTGCCAGTCGGATAGTGTTCCGAG

Entity 9 Entity 9 polymer

Description description	Histone H3.2
Molecular weight formula_weight	15289.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,Q

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Histone H4
Molecular weight formula_weight	11263.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,R

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Histone H2A type 1
Molecular weight formula_weight	13990.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,S

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Histone H2B type 1-C/E/F/G/I
Molecular weight formula_weight	13806.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,T

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 13 Entity 13 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 14 Entity 14 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.34 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	33937

CryoEM Structure INO80core Nucleosome complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

RuvB-like helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like helicase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

les2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ies6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin related protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3.2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A type 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B type 1-C/E/F/G/I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6fml__assembly_1__model_1

6fml__assembly_1__model_1 | I(q)

6fml__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment