8x19

Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H2A type 1-C

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1C_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–130； UniProt 1–130 Author chain E； PDBConstruct 1–130； UniProt 1–130

Histone H2B type 1-C/E/F/G/I

Homo sapiens

UniProt P62807

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1C_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–126； UniProt 1–126 Author chain F； PDBConstruct 1–126； UniProt 1–126

Histone H3.1

Homo sapiens

UniProt P68431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H31_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–136； UniProt 1–136 Author chain G； PDBConstruct 1–136； UniProt 1–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–103； UniProt 1–103 Author chain H； PDBConstruct 1–103； UniProt 1–103

Helicase SRCAP

Homo sapiens

UniProt Q6ZRS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRCAP_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–3230； UniProt 1–3230

Vacuolar protein sorting-associated protein 72 homolog

Homo sapiens

UniProt Q15906

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPS72_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–364； UniProt 1–364

Actin-related protein 6

Homo sapiens

UniProt Q9GZN1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–396； UniProt 1–396

Zinc finger HIT domain-containing protein 1

Homo sapiens

UniProt O43257

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZNHI1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain L； PDBConstruct 1–154； UniProt 1–154

RuvB-like 1

Homo sapiens

UniProt Q9Y265

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–456； UniProt 1–456 Author chain O； PDBConstruct 1–456； UniProt 1–456 Author chain Q； PDBConstruct 1–456； UniProt 1–456

RuvB-like 2

Homo sapiens

UniProt Q9Y230

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–463； UniProt 1–463 Author chain P； PDBConstruct 1–463； UniProt 1–463 Author chain R； PDBConstruct 1–463； UniProt 1–463

Actin, cytoplasmic 1

Homo sapiens

UniProt P60709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain S； PDBConstruct 1–375； UniProt 1–375 Author chain U； PDBConstruct 1–375； UniProt 1–375

Actin-like protein 6A

Homo sapiens

UniProt O96019

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACL6A_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain T； PDBConstruct 1–429； UniProt 1–429

DNA methyltransferase 1-associated protein 1

Homo sapiens

UniProt Q9NPF5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） YEATS domain-containing protein 4 × 1 （O95619） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DMAP1_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain V； PDBConstruct 1–467； UniProt 1–467

YEATS domain-containing protein 4

Homo sapiens

UniProt O95619

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 23 DNA 2	Histone H2A type 1-C × 2 （Q93077） Histone H2B type 1-C/E/F/G/I × 2 （P62807） Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Helicase SRCAP × 1 （Q6ZRS2） Vacuolar protein sorting-associated protein 72 homolog × 1 （Q15906） Actin-related protein 6 × 1 （Q9GZN1） Zinc finger HIT domain-containing protein 1 × 1 （O43257） RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Actin, cytoplasmic 1 × 2 （P60709） Actin-like protein 6A × 1 （O96019） DNA methyltransferase 1-associated protein 1 × 1 （Q9NPF5） DNA (147-MER) × 1 DNA (147-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 1 BERYLLIUM TRIFLUORIDE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YETS4_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain W； PDBConstruct 1–227； UniProt 1–227

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8x19
Deposition date deposition_date	2023-11-06
Structure title title	Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
Keywords keywords	Remodeler; SRCAP; H2A.Z, DNA BINDING PROTEIN/DNA, DNA BINDING PROTEIN-DNA complex; DNA BINDING PROTEIN/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8x19__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8x19__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8x19__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.97 Å
Rg (electron density)	69.14 Å
Total Rg	69.15 Å
Atom count	56704
Residues	6666
Excluded volume	991800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8x19__assembly_1__model_1`	25-meric （25）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Histone H2A type 1-C
Molecular weight formula_weight	14135.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	56704

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H2B type 1-C/E/F/G/I
Molecular weight formula_weight	13937.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H3.1
Molecular weight formula_weight	15437.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Histone H4
Molecular weight formula_weight	11394.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Helicase SRCAP
Molecular weight formula_weight	343915.2 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQSLNQPLTSSKAGSSPCLGSSSAASSPPPPASRLDDEDGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSDTRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAEEQLEGEVDHAMELSELAREGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQADEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQVKTPIPLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQTTTKETLATGHFMSVINILMQLRKVCNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQRIDMGRFDLIGLEGRVSRYEADTFLPRHRLSRRVLLEVATAPDPPPRPKPVKMKVNRMLQPVPKQEGRTVVVVNNPRAPLGPVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSGSLPQVLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAPPPGSSSLLKPLTVPPGYTFPPAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLPSGEVVSIGQLASLAQRPVANAGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHVALIQAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDGLTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHSPSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLPISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASPSASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFPSAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAPVLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQTLALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPLGPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGPAAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSPPSTATSFGGPRPRRQPPPPPRSPFYLDSLEEKRKRQRSERLERIFQLSEAHGALAPVYGTEVLDFCTLPQPVASPIGPRSPGPSHPTFWTYTEAAHRAVLFPQQRLDQLSEIIERFIFVMPPVEAPPPSLHACHPPPWLAPRQAAFQEQLASELWPRARPLHRIVCNMRTQFPDLRLIQYDCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFNADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSSSVPSAPEEEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAGEGEEAGRPGAEDEEMSRAEQEIAALVEQLTPIERYAMKFLEASLEEVSREELKQAEEQVEAARKDLDQAKEEVFRLPQEEEEGPGAGDESSCGTGGGTHRRSKKAKAPERPGTRVSERLRGARAETQGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIPALVPVPVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPPAQTCLVTPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLVPPKDLLPVAVEILPVSEKNLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGEELPLCVSESNGLELPPSAASDEPLQEPLEADRTSEELTEAKTPTSSPEKPQELVTAEVAAPSTSSSATSSPEGPSPARPPRRRTSADVEIRGQGTGRPGQPPGPKVLRKLPGRLVTVVEEKELVRRRRQQRGAASTLVPGVSETSASPGSPSVRSMSGPESSPPIGGPCEAAPSSSLPTPPQQPFIARRHIELGVTGGGSPENGDGALLAITPPAVKRRRGRPPKKNRSPADAGRGVDEAPSSTLKGKTNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEKRRRGRPPKARDLPIPGTISSAGDGNSESRTQPPPHPSPLTPLPPLLVCPTATVANTVTTVTISTSPPKRKRGRPPKNPPSPRPSQLPVLDRDSTSVLESCGLGRRRQPQGQGESEGSSSDEDGSRPLTRLARLRLEAEGMRGRKSGGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPKLRSTRLRPGSLVPPLETEKLPRKRAGAPVGGSPGLAKRGRLQPPSPLGPEGSVEESEAEASGEEEEGDGTPRRRPGPRRLVGTTNQGDQRILRSSAPPSLAGPAVSHRGRKAKT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Vacuolar protein sorting-associated protein 72 homolog
Molecular weight formula_weight	40658.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLPGSGPRALRQKIVIK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Actin-related protein 6
Molecular weight formula_weight	45857.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTTLVLDNGAYNAKIGYSHENVSVIPNCQFRSKTARLKTFTANQIDEIKDPSGLFYILPFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQFQAVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSLFPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEENGHSVCEEKFDI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	Zinc finger HIT domain-containing protein 1
Molecular weight formula_weight	17567.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	RuvB-like 1
Molecular weight formula_weight	50296.9 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,O,Q

MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	RuvB-like 2
Molecular weight formula_weight	51222.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,P,R

MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,U

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	Actin-like protein 6A
Molecular weight formula_weight	47509.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	DNA methyltransferase 1-associated protein 1
Molecular weight formula_weight	53090.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAGHERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEELVHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAEPAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	YEATS domain-containing protein 4
Molecular weight formula_weight	26541.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	DNA (147-MER)
Molecular weight formula_weight	45644.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

ACAGGATGTATATATGTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAG

Entity 16 Entity 16 polymer

Description description	DNA (147-MER)
Molecular weight formula_weight	45105.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCACATATATACATCCTGT

Entity 17 Entity 17 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 18 Entity 18 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	475617

Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H2A type 1-C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B type 1-C/E/F/G/I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Helicase SRCAP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 72 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zinc finger HIT domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer