← Back to search

9qfj

Cryo-EM structure of the cofilactin filament core at 2.3 Angstrom resolution.

Method: ELECTRON MICROSCOPY D_max: 180.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qfj
deposition_date	2025-03-11
title	Cryo-EM structure of the cofilactin filament core at 2.3 Angstrom resolution.
keywords	actin, cofilin, filament, cytoskeleton, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	49.92 Å
rg_electron	50.10 Å
i0	1229060000.00
molecular_weight	293960.0 kDa
excluded_volume	368890 Å³
envelope_volume	498340 Å³
shell_volume	83710 Å³
envelope_diameter	178.1 Å
shell_rg	52.53 Å
envelope_rg	49.86 Å
shape_rg	50.10 Å
total_rg	50.17 Å
total_atoms	20610
n_residues	2615
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	180.3 Å
rg_real	50.10 Å
rg_real_error	2.52 Å
i0_real	1.2290e+09
i0_real_error	2.4610e+07
rg_reciprocal	49.93 Å
i0_reciprocal	1229000000.0000
total_estimate	0.8580
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	56.3 Å
skewness	0.414
kurtosis	-0.323
angular_range	— – 0.1600 Å⁻¹
current_alpha	0.0000
highest_alpha	100100000.0000
n_real_points	33
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.745; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.965; Smooth: 0.949

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Cofilin-1
formula_weight	18532.5 kDa
src_method	man
entity_count	5

Polymer

type	polypeptide(L)
strand_id	G,F,H,I,J
atom_count	21467

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21(DE3)

Entity 2 polymer

description	Actin, cytoplasmic 1, N-terminally processed
formula_weight	41632.4 kDa
mutation	C272A
src_method	man
entity_count	5

Polymer

type	polypeptide(L)
strand_id	A,B,C,D,E

DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Trichoplusia ni

Entity 3 non-polymer

description	ADENOSINE-5'-DIPHOSPHATE
formula_weight	427.2 kDa
src_method	syn
entity_count	5

Entity 4 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	5

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	857

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	2.31 Å
resolution_method	—
num_particles	4767360

fit	/app/data/saxs_computation/qf/9qfj/9qfj.fit
pddf	/app/data/pr_computation/qf/9qfj/9qfj.pr.out
profile	/app/data/saxs_computation/qf/9qfj/9qfj.dat

Cryo-EM structure of the cofilactin filament core at 2.3 Angstrom resolution.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (5)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)