6ltj

Structure of nucleosome-bound human BAF complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3.3

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H33_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–136； UniProt 1–136 Author chain E； PDBConstruct 1–136； UniProt 1–136

Histone H4

Xenopus laevis

UniProt P62799

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–103； UniProt 1–103 Author chain F； PDBConstruct 1–103； UniProt 1–103

Histone H2A type 1

Xenopus laevis

UniProt P06897

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–130； UniProt 1–130 Author chain G； PDBConstruct 1–130； UniProt 1–130

Histone H2B

Xenopus laevis

UniProt Q92131

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q92131_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–126； UniProt 1–126 Author chain H； PDBConstruct 1–126； UniProt 1–126

Transcription activator BRG1

Homo sapiens

UniProt P51532

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMCA4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–1647； UniProt 1–1647

Actin-like protein 6A

Homo sapiens

UniProt O96019

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACL6A_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–406； UniProt 12–417

Actin, cytoplasmic 1

Homo sapiens

UniProt P60709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–375； UniProt 1–375

AT-rich interactive domain-containing protein 1A

Homo sapiens

UniProt O14497

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARI1A_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain L； PDBConstruct 1–1295； UniProt 991–2285

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

Homo sapiens

UniProt Q12824

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNF5_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–113； UniProt 1–113 Author chain M； PDBConstruct 123–336； UniProt 172–385

SWI/SNF complex subunit SMARCC2

Homo sapiens

UniProt Q8TAQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRC2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–1214； UniProt 1–1214 Author chain O； PDBConstruct 1–1214； UniProt 1–1214

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1

Homo sapiens

UniProt Q96GM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRD1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain P； PDBConstruct 1–515； UniProt 1–515

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1

Homo sapiens

UniProt Q969G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） Zinc finger protein ubi-d4 × 1 （Q92785） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMCE1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Q； PDBConstruct 1–411； UniProt 1–411

Zinc finger protein ubi-d4

Homo sapiens

UniProt Q92785

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 18 DNA 2	Histone H3.3 × 2 （Q6PI79） Histone H4 × 2 （P62799） Histone H2A type 1 × 2 （P06897） Histone H2B × 2 （Q92131） Transcription activator BRG1 × 1 （P51532） Actin-like protein 6A × 1 （O96019） Actin, cytoplasmic 1 × 1 （P60709） AT-rich interactive domain-containing protein 1A × 1 （O14497） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 × 1 （Q12824） SWI/SNF complex subunit SMARCC2 × 2 （Q8TAQ2） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 × 1 （Q96GM5） SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 × 1 （Q969G3） DNA (119-MER) × 1 DNA (119-MER) × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	REQU_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain R； PDBConstruct 1–100； UniProt 1–100 Author chain R； PDBConstruct 110–292； UniProt 209–391

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ltj
Deposition date deposition_date	2020-01-22
Structure title title	Structure of nucleosome-bound human BAF complex
Keywords keywords	Chromatin remodeler, Complex, GENE REGULATION; GENE REGULATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ltj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ltj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ltj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.16 Å
Rg (electron density)	64.10 Å
Total Rg	64.28 Å
Atom count	34283
Residues	3894
Excluded volume	596150 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ltj__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Histone H3.3
Molecular weight formula_weight	15361.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	34283

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 polymer

Description description	Histone H4
Molecular weight formula_weight	11394.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli BL21

Entity 3 Entity 3 polymer

Description description	Histone H2A type 1
Molecular weight formula_weight	13993.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli BL21

Entity 4 Entity 4 polymer

Description description	Histone H2B
Molecular weight formula_weight	13873.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MSDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAGRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli BL21

Entity 5 Entity 5 polymer

Description description	Transcription activator BRG1
Molecular weight formula_weight	184923.8 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Actin-like protein 6A
Molecular weight formula_weight	45236.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

GALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	AT-rich interactive domain-containing protein 1A
Molecular weight formula_weight	142316.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Molecular weight formula_weight	38015.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISGGSGGSGGSDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	SWI/SNF complex subunit SMARCC2
Molecular weight formula_weight	133048.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,O

MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Molecular weight formula_weight	58311.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Molecular weight formula_weight	46710.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	Zinc finger protein ubi-d4
Molecular weight formula_weight	32781.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPGGSGGSGGSYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	DNA (119-MER)
Molecular weight formula_weight	36520.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

TGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGA

Entity 15 Entity 15 polymer

Description description	DNA (119-MER)
Molecular weight formula_weight	36929.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

TCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCA

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6ltjA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

Domain ID domain_id	6ltjH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	20 — Histone, subunit A
Homologous superfamily homologous superfamily	10 — Histone, subunit A

▶

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	320658

Structure of nucleosome-bound human BAF complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone H3.3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A type 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription activator BRG1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-like protein 6A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AT-rich interactive domain-containing protein 1A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI/SNF complex subunit SMARCC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer