7xtd

RNA polymerase II elongation complex transcribing a nucleosome (EC58oct)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R4Y0_KOMPG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1743； UniProt 1–1743

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt C4QZQ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QZQ7_KOMPG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1227； UniProt 1–1227

RNA polymerase II third largest subunit B44, part of central core

OrganismNot specified

UniProt C4R7L2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R7L2_KOMPG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–304； UniProt 1–304

RNA polymerase II subunit B32

OrganismNot specified

UniProt C4R2U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R2U9_KOMPG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–186； UniProt 1–186

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt C4R3P8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3P8_KOMPG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–214； UniProt 1–214

RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R1V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R1V1_KOMPG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

RNA polymerase II subunit

OrganismNot specified

UniProt C4R9A1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R9A1_KOMPG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt C4R273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R273_KOMPG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–145； UniProt 1–145

DNA-directed RNA polymerase subunit

OrganismNot specified

UniProt F2QPE6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2QPE6_KOMPC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–115； UniProt 1–115

RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R009_KOMPG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–72； UniProt 1–72

RNA polymerase II subunit B12.5

OrganismNot specified

UniProt C4R3Z5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3Z5_KOMPG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–118； UniProt 1–118

RNA polymerase subunit ABC10-alpha

OrganismNot specified

UniProt F2QMI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2QMI1_KOMPC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–72； UniProt 1–72

Transcription elongation factor 1 homolog

Komagataella phaffii

UniProt C4QZ45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QZ45_KOMPG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 4–113； UniProt 1–110

Transcription elongation factor SPT4

Komagataella phaffii

UniProt C4R0E6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R0E6_KOMPG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain V； PDBConstruct 2–108； UniProt 8–114

Transcription elongation factor SPT5

Komagataella phaffii

UniProt C4R370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R370_KOMPG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain W； PDBConstruct 4–911； UniProt 1–908

Transcription elongation factor Spt6

Komagataella phaffii

UniProt C4R7H2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R7H2_KOMPG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain m； PDBConstruct 4–1503； UniProt 1–1500

Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II

Komagataella phaffii

UniProt C4R7L8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R7L8_KOMPG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain n； PDBConstruct 4–417； UniProt 1–414

Component of the Paf1p complex

Komagataella phaffii

UniProt C4R6B2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R6B2_KOMPG
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain q； PDBConstruct 41–1084； UniProt 1–1044

RNAPII-associated chromatin remodeling Paf1 complex subunit

Komagataella phaffii

UniProt F2QQ42

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2QQ42_KOMPC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain r； PDBConstruct 31–544； UniProt 1–514

Leo1

Komagataella phaffii

UniProt C4R3K1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3K1_KOMPG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain u； PDBConstruct 31–459； UniProt 1–429

RNAP II-associated protein

Komagataella phaffii

UniProt C4R997

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R997_KOMPG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain v； PDBConstruct 4–396； UniProt 1–393

Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p

Komagataella phaffii

UniProt C4R1E6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R1E6_KOMPG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain x； PDBConstruct 31–395； UniProt 1–365

Histone H3.3

Homo sapiens

UniProt P84243

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H33_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain a； PDBConstruct 4–139； UniProt 1–136 Author chain e； PDBConstruct 4–139； UniProt 1–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain b； PDBConstruct 4–106； UniProt 1–103 Author chain f； PDBConstruct 4–106； UniProt 1–103

Histone H2A type 1-B/E

Homo sapiens

UniProt P04908

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1B_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain c； PDBConstruct 4–133； UniProt 1–130 Author chain g； PDBConstruct 4–133； UniProt 1–130

Histone H2B type 1-J

Homo sapiens

UniProt P06899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） FACT complex subunit × 1 （C4QYQ8） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1J_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain d； PDBConstruct 4–129； UniProt 1–126 Author chain h； PDBConstruct 4–129； UniProt 1–126

FACT complex subunit

Komagataella phaffii

UniProt C4QYQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit POB3 × 1 （F2QNN8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QYQ8_KOMPG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain j； PDBConstruct 4–1008； UniProt 1–1005

FACT complex subunit POB3

Komagataella phaffii

UniProt F2QNN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 32 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） Transcription elongation factor 1 homolog × 1 （C4QZ45） DNA (198-MER) × 1 ;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ; × 1 DNA (198-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Transcription elongation factor SPT5 × 1 （C4R370） Transcription elongation factor Spt6 × 1 （C4R7H2） Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II × 1 （C4R7L8） Component of the Paf1p complex × 1 （C4R6B2） RNAPII-associated chromatin remodeling Paf1 complex subunit × 1 （F2QQ42） Leo1 × 1 （C4R3K1） RNAP II-associated protein × 1 （C4R997） Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p × 1 （C4R1E6） Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） FACT complex subunit × 1 （C4QYQ8） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2QNN8_KOMPC
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain k； PDBConstruct 4–531； UniProt 32–559

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7xtd
Deposition date deposition_date	2022-05-16
Structure title title	RNA polymerase II elongation complex transcribing a nucleosome (EC58oct)
Keywords keywords	chromatin, nucleosome, TRANSCRIPTION, TRANSCRIPTION-DNA-RNA complex; TRANSCRIPTION/DNA/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7xtd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7xtd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7xtd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	80.64 Å
Rg (electron density)	80.03 Å
Total Rg	80.03 Å
Atom count	81668
Residues	9766
Excluded volume	1437800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7xtd__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (33)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	194107.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	81668

MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGSIDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNPTMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGMKLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVLPVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFHVATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNLELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHKRAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDTFIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLSPKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLHNGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVSRTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGFADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYVDLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPVNLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLFQCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSIEYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELDRARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEEDQMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVMAVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTSRGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMGTGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFSPMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESKEGE

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	139746.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQPAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDMEKSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDLYKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSRLISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDWQMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQEEGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTREIYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISIGSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSGAISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYDDDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLNDTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIAPGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEGLKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKKLMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAAKLLFQELMAMNIAPRLYTERSGVSMRS

Entity 3 Entity 3 polymer

Description description	RNA polymerase II third largest subunit B44, part of central core
Molecular weight formula_weight	34216.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADEFISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIKVSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEYDPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKANQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDYNAPY

Entity 4 Entity 4 polymer

Description description	RNA polymerase II subunit B32
Molecular weight formula_weight	20623.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLIREALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEETCTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNRLEDPYK

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	24962.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRSETSGRYASYRICL

Entity 6 Entity 6 polymer

Description description	RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III
Molecular weight formula_weight	17803.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGTIKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQIAMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN

Entity 7 Entity 7 polymer

Description description	RNA polymerase II subunit
Molecular weight formula_weight	18802.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGRIIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLVYNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLANSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGLLMCLEGGYKSLASLKQDNLYILIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	13612.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE

Entity 10 Entity 10 polymer

Description description	RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III
Molecular weight formula_weight	8554.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFLRYNPLEKKDFDS

Entity 11 Entity 11 polymer

Description description	RNA polymerase II subunit B12.5
Molecular weight formula_weight	13832.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVAYKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND

Entity 12 Entity 12 polymer

Description description	RNA polymerase subunit ABC10-alpha
Molecular weight formula_weight	7862.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYKARTKRMIQFDAR

Entity 13 Entity 13 polymer

Description description	Transcription elongation factor 1 homolog
Molecular weight formula_weight	12606.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

GPGMGKRKSSARKPAPKIKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCNLSFQAPINSLSQPIDIYSDWIDACEAVAEENADVNGDNFIENDGADREQDDDYDDEF

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 14 Entity 14 polymer

Description description	DNA (198-MER)
Molecular weight formula_weight	61381.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

GCTTACGTCAGTCTGGCCATCTTTGTGTTTGGTGTGTTTGGGTGGTGGCCGTTTTCGTTGTTTTTTTCTGTCTCGTGCCTGGTGTCTTGGGTGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT

Entity 15 Entity 15 polymer

Description description	;RNA (5'-R(PUPGPUPAPAPUPCPCPCPCPUPUPGPGPCPGPGPUP*U)-3') ;
Molecular weight formula_weight	6008.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

UGUAAUCCCCUUGGCGGUU

Entity 16 Entity 16 polymer

Description description	DNA (198-MER)
Molecular weight formula_weight	60870.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACACCCAAGACACCAGGCACGAGACAGAAAAAAACAACGAAAACGGCCACCACCCAAACACACCAAACACAAGAGCTAATTGACTGACGTAAGC

Entity 17 Entity 17 polymer

Description description	Transcription elongation factor SPT4
Molecular weight formula_weight	12039.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MRERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGLVAVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRPRDGSVID

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 18 Entity 18 polymer

Description description	Transcription elongation factor SPT5
Molecular weight formula_weight	101459.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

GPGMSETHKNQLDKVSTVSPDGPSEAVKEHSLQSKDLSKNDGQFIVPLDRNVIEQEEHKQVKSSAQAHNTTGDAADNEIEDGVPSEDVEFDKFKEDDYDEDDEVEEEGDIRSRKRRRHNQFLDVEAEVDDEEDDDDDDDDVELKHDFIQDDHIQHETQNEGFIAGHVDDDRLHRKLDQSREKIADQDAQELADEFKQRYGRSASSKYMGSASTTAPQRLLIPTVDDPGIWGVKVRLGKEKDVVRQILKKKLAREGTKNPLEIYSAFQRDSFKGHVYIEARKAEAINDALKGNVNVFSNNSKFLVGIVEYKDLLRPVKSSDVKLTRGSYVRVKNGKFKGDLAQVDEVLENGLEARLKLVPRLDYGKDLSHLSTSSSVDSTKNRRKFYTSKFRPAQRLFSEAEARVHEPTIRRDRDGFVTYGGEEYYEGFLYKTFRLQNLIVNSINPTLNELSLFQSNEESTTIDLSTIADSLKETAKNLVSFQPGDNVEIINGELNHLTGTVSSVNQSTIVSVRLHSDDDTINSETVEIPTSDLRKIFNVGDHVRVIHGKHTDDTGLIVEVNGDKVEFISNQTKRTVIVFSNYLIKSTDSTVSINESGRFELHDLVQVNSDLVGIVIRAQKDSFDVLCSDGKLLSLPPVSIYSKLNLNPNQQIAIDSNGVEVKVGDTVREFTGERRQGTILHVYRNFLFLRSREIVENQGVFVTSSNRVKTITSKSNGTGGQISGPDLSRMNPSRVIPPPSIPVANQRMTGRDPTLNKTVKIRQGGYKGKIGIVKEANGDRFRVELHNPNKTIPIPCSFLLIESTHGWVPYEDFVASDRRGGNIPRHEISGHVQQPQHGRAPAWGSGGKTPAWGSGGKTPAWGSGGSGGKTPAWGSGGKTPTWGSGAKTPAWGSGSKTPAWSGLDEEDRRDF

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 19 Entity 19 polymer

Description description	Transcription elongation factor Spt6
Molecular weight formula_weight	173241.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

GPGMSAPSPSVSEEDINETRNSIDADASTVQDLLDQDAQEGSGSDNEGSNIVDSSEEDDDEDDEEEMQKVREGFIVDDDDENDEDGIPSSTKRKHRKKHKKRSAEVVEEVDEDDLQLLMENSGAVPGQQQNVKFKRLKRAEQDEKAQDSDSRGLNDMFSDEEGPGGVVEEGSEEEGLEDNLTTKTQRSGNLPHDEFDDFIEEDEFSDEDDEARDERLARMRSAKAAPQLAGLQGEQYQEIIEIFGDGTDYQWTLDAEEEMEQPQQDQEYDEAGEEIKGTTTSLADVFEPSELKEKMLTDEDNVIRVTDLPERFQAYRKSIKNYKLSDVDYSNERDWIVEQLKLEKRDFLQHLTQAHSSVAHLEEKFEASVKKIVDFIAIESFEVPFIWNHRRDYALHTYNDDSNNTIIVKLLNEDDLWRIVQLDLDYHSIHDKKAALSSIYKQLDLDVVDPTYEEFFGSARTLSELQDIDDYLTFNYSSQVKNLTAVAELSIEGNGSGEDEEQTTKSSFAEVKMKRKYSKYAIYDRIRQDAIYPVVQSIANISQMRENLAQSKRLHQVEDPIESPMDMIADIMSTEKDKTTFISSEKAYQAVKQFFSEQLSYEPFIRKTIRTAFQSFGVINIELTERGKLQIEPESPYFDFKYAKNRPISALTATPDLYLRMIQAENDGLVNIKVELPMLSTVVDHFYNILKSDGTSEISEKWNALRNDAWKQSLDKLIPLVQLNVKESIRRDCERVLYFQVKNSFTKKIDQAPYQPPTYAKGTIPRVLTLSFGEGNRGDAVLGVFMDDSGDVKSQIKFDEDFQSRDFSDSLTRYIKSNNINPDIIGISGFNIHTKKLFDKVNELVNEERLTIEYDNEYGYDREEDGRSDKHLIRVIYVNDETARLYQHSSKSSAEYPNRPQLAKYCIGLAKYIQSPLLEYLALDESMYSLHIHKHQNLLPREKLIDAVQTSIVDIVNLVGVDINEAVRAPYHALALPYVCGLGPRKAAGLIQSIQRIGSNLVNRAHLITEQLTSKTVFLNMASFVYIVFDPDVERNPQGEMDLLDSTRIHPEDYSLARKMAADALDIEDIDDDDESAMRNAIYEMVFPRSPPKDEDDLTFKLDELILDDYATELERKHQLKKRSTLQIIKEELQSRYREIRRDFHILNEAEIFQLLTRETVDSFRKGMVIPVYVRKVESSYMSVSTQSLIAGNIQRQDILEPNDRRDPREVYSVGQTVRACILDVDYYNFKCQLSLLRQFTENQVAGLNVNRNPKFWDIESENRDRQEEIDKQREESRESRVIKHPFFHNMKSKEAEDYLAARPVGDVVIRPSSKGSNHITISWKVAPQLYQHIDVLEENKDDANAIGRVLLVGKYRYHDLDELLVEYVNNVANKVELMVSHDKFMSDSLDYVKEWLERYSKANGNRSHYIFTFNRKAPGWFFLLFKLNPTSEIKIWNVKALPDGYLLANNVYPDTNSLCNGFKTLMSSRRQIKQRSNRAGGEYNNSHAGAYDNGYSNAPRY

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Spodoptera frugiperda

Entity 20 Entity 20 polymer

Description description	Protein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II
Molecular weight formula_weight	46907.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

GPGMSDEESENKKLLDQVLPEKTDQETQPEADAALAEQEAPENEPNEPASDDDSDSDLSDISDVDEEKVAEGLRYLDEQTAASLSKHKAAQPSSTHKKKEPTRRRPKQQTARETQYEPDVVEDEAARRTRLFEEKLDAAIKRKPNKRKKNDDVDLEQMQDELIQQLKLQMEESAIRDANNIEQGKPAIFKLKLLPKVKDILLRANLADSILDNNLLASVRLWLEPLPDASLPAYQIQKVLFDAIKSLPIKTSHLRESGLGKVMVFYQKSKRVEPNLKRTAEKLISDWTRPIMGASDNYKDMRVRTQQFDPAQFAESLPGRVSVRPQEAKTLYEEAAERRKRAAIPQARTAAYTIAPQVNTELLMSSARRTLPSGVGSSLSGEDQYKRLNSRLNTMGTKRKSSAKKGGISIEGRGLPQ

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 21 Entity 21 polymer

Description description	Component of the Paf1p complex
Molecular weight formula_weight	124979.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MKDHLIHNHHKHEHAHAEHDYKDDDDKEHLYFQGSSGSSGMSLLDQDYYLSALPEDKRAELVTLQLTIPLKSGDEVVTIDFNEDVDVSQLCVLLESENARPDLWLSAAKVFVSKGNIAGSQEIIRKALQSNVILDSSASVTSLFHNFSFWLSLMEYVSTNSREDQFLEYASNSLQASNSLDSGLILNGIGNGVLYAKSRRYDEALKEFDNLLKKKSTNILAILGKAQILYKRQKYSQALELYQKALTINPLIVPDPRLGIGLCFWHLNNKQLAEQAWHNSLKVHPQNNLNTKILICLAKFDYCFNESKDDDEFTALYRESLEFLHSCLKEDAKHPLLLMVLASYYFSKEDYEKVEKLCNLVLKENSRNAAFVSASHFWLARVAYHKEDYVQAQKQFKQAEDSQNSNTLAKLGYAQCLIARNEVGDATIYLEKFFKENQDSKSSEMMLLLGIIYSQSGKSYYKAIIFLEKYVAVCQEENYPILPEAYLVLSRVYENKDLNVALDYLMKANDILGDKANVYVLNNLGIYHFFRNNVSQSSDFFAQSLEALNNVSPQNKEALSITLHYNKARVEEVSNQSEAEKLYSKLMEKCPGYTSNKIRYIYLLALKSNGNNYADVQQLLDDFPSDLEVRSFYGWFLKRYGRKNGLKQDLESQHHKDTLINYDKHDCYALLSLGNIYATIAREMKVTDQKQNEIKRQQYLRAAQFYHKVLSIDPKNIYAAQGIAIIFSDKERTGLALEIFKKVRDTVQDLGTFINLGHCFMEAKQFGKAIESYTIALEKFSNGMDSKLLVLIGRAWYHRGFYEKSMDAYKKALEVSEQAYQLSKLPALRFNIVFIQFQIADFVKSLPNTQRDLTTLENALSGLNDAIKSLLKLAELEQPPYPSEDLKARATMGSNTLRNQLERAIQDQQDYEMSIQEKLRTARRKQQLDEEKRLEQEQRRLEEARKRQEAELIKRQELIKQAEEWNKMDIDAAKDNNDVLSEDGGEGEKKTTKKRKRKQKVSEDIAPDLDRINEENGNTEDYDPILDNEEEENYDEKDSENKENGQNGQNEEVYPESEGDDEDDVTNTKRQKRSKGIVDEEDSE

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 22 Entity 22 polymer

Description description	RNAPII-associated chromatin remodeling Paf1 complex subunit
Molecular weight formula_weight	62301.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MKDHLIHNHHKHEHAHAEHLYFQGSSGSSGMSDKEQDLDEDLLALAGAGSDSESNSAYSPEQEVSRKSKKIVNDSEDENNDSDGEQLLNPYPLEDKFKDEADRARLLGLSEMEREAILYERSQEVIKLKEKHLLSLRAKQSQLEKTAREGPKSSKTNKLSELKKQREQKSKRQRSDEYSDEEDDYRYEEVGDNDDVEMSDNYIDEDDAVFVEPKKSSRSQELSKPATLSDINKIIFGRTAMSKYWYYPEFDDVVKGMYLRLNTGSGGNGFSPYKVVEVLGSQRIKGSAYGLNSKENNCDMYLKVAFPNQKEMVRPLFVFSDSSITHPEFDLFLRELDAEGLSVMDLRDVDYKYHQLKEMSSRSLSNDEVNSIVKMKQSLSSNTGFNTVLKKAQLQEELEEARDAHDHERVARIEAELKSIGAESVVASKASSSMLKIDQRNKKLNNRFIRKAEMAAVEKRKLRGTSESDPFYRLATTARMFYKSANLGADDSNQPKTKAELEEEAKQEKKLEMQKLESMVKSNYRNGGLDRIISKIDFDFDLEL

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 23 Entity 23 polymer

Description description	Leo1
Molecular weight formula_weight	52387.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MKDHLIHNHHKHEHAHAEHLYFQGSSGSSGMSQELEQNRHSGEESPDPVLDANTSDVDDDGLDLFGDDDDEQPEAKPGQLDDSSNDAEEDEQEKAGKPEAKVTSHTKSVYDNGETLDISLPIHPKSHIPQGKQDRWVVKLPDFLDINAEPFDPRPFEMNVKTHEDKNQELLDKLIAVNTVRWRYAKSETGGIFKETNSQIIQWEDGTYSLRVGSEIFDMFTTNTDDNYLVSEHNEEGILMTESTLSKSVKLVPASFQSTTHQKLAKALSAKQKKESYARSVVTKEDPEERQRRLESQENERYRLERRRKQAEEEEDYDSYAVSTSRSRPSRASQMYNAADEDDDDDDVAIGRTLASRRNNGYEDDGFIIDDEEEEEAVENDSADEESENEGDDDEEDDEEAAERLNRLKRAGASKYTNEGEQAQSEPVKSEEADNASQRDDAPRKKRRVILDDDEEEEE

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 24 Entity 24 polymer

Description description	RNAP II-associated protein
Molecular weight formula_weight	46046.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

GSAMTSSKSRQDYIAKVRYQNDLPAPPCPPKLLKYEIEKEAPQKEFLKDSRLLSALFSKDNFRYLMNETSDGLDVNYLRIPGIIENEKSLGKLFSSYKNLAIENLHPDDRLLLVDPNKSATLNEESPVFFLRRPQYVSDGEKINLQNFTNKRKHQDMEDTNPRSQLHSVERTFDEVIDPRNKNRLQSLIHPRKKIKAVKAWHFFPDTSTFDQVFHSLKFVGSASLSKDRPLNEQLGQVSETDSTSVNASILTSLFKPIEINPHNKWISLYAVTDKLSAESFRKSFNSIKDDNIVNRHVIYDHIKDFDQMFRGHKKLFEDFAISFDDISDRAFFVPIVGRLELKKKRIVPGLVDMVNRTNYAHIRMDLRNPSTQETAIRDSRREQYDPVNYSSIQEE

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 25 Entity 25 polymer

Description description	Constituent of Paf1 complex with RNA polymerase II, Paf1p, Hpr1p, Ctr9, Leo1, Rtf1 and Ccr4p
Molecular weight formula_weight	44760.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MKDHLIHNHHKHEHAHAEHLYFQGSSGSSGMSEPLIALRQAIKDKKPVGVNEGETIGNAKVLNIGEKQYSLDAPTSFVINGKEFNLKVIYQCWVFRDSSSADYITECEKENIDGISFVERSELISWLKGEITSSAFIKGEKVGITEENGKNEGETKSNNKRKLSDDPLLKEIASNERVLIDHNKVLRGLKPKDFSSVAKDCELRILKEKPANAKSSDSNGRSSTSVSSSSKDARNKEPIIVLSPAASSLVRMSNVKEFLQEGKFLDPSKEPASSSNLLAIQRKSSRFKTPIKLLVVDNVEKLFTKSEYWDRVVAIVTTGKDWQFKNYKYKDPQILFQKFNGFYFKYKGDAVPASVKSWNVKVLDIDRVERFSDRQVVEQFWDTVENTLVAKRYKS

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 26 Entity 26 polymer

Description description	Histone H3.3
Molecular weight formula_weight	15643.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,e

GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 27 Entity 27 polymer

Description description	Histone H4
Molecular weight formula_weight	11676.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,f

GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 28 Entity 28 polymer

Description description	Histone H2A type 1-B/E
Molecular weight formula_weight	14447.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,g

GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 29 Entity 29 polymer

Description description	Histone H2B type 1-J
Molecular weight formula_weight	14217.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,h

GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 30 Entity 30 polymer

Description description	FACT complex subunit
Molecular weight formula_weight	115220.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

GPGMSEVKIDPVAFKNRLGAIQRKLNSSNEIFQGITTLLVVVGSSDESNPYKKSTILHNWLLGYEFPATALAITKNSITFLTSVGKAKYLTPLQNVTTVKILARNKDSEHNEALFDQFIDQLKSSVDDSKRLGVITKDKFTGSFYQDWLKKWDAAKSDFELVDVATGLSQATEYKDEEEQKFIRTASKATVNMMTVFTDEVINIIDEDLNFTNNQVVDKIENKIDDTKFWKTLEQNKSMKKLGGDFEIGQLDWCYRPIVQSGGKYELKFSAESNDDKLTSGVILASLGLRYNSYCSNVSRTLLIDPSREINKNYDFLLELRSYIMNQIKDGAVCKDVYAKALAMVNKDRPDLAKHFVKNIGSLIGLEFRDSTMVLNAKNDRVIHDGSVINLVLGFQQLKDESQPLGTYSLLIADTVRITGGEPILLTDSPISRSEISFYFKDEEGEDKKPRVKDEPTSRKIEKPEVSAPARGSKILKSKLRNETTNTEEEKERLRKEIQKQLHEKIQKEGLARFNKSDAQDGNENHAVFKRYESYVRESQIPSKVKNLRISIDPKAQTIILPICGRPVPFHINSFKNGSKNEEGDYMYIRLNFNSPGMGSSVKKTELPYEDGDDKEFVRSLTFRSTNKERMSEVFKAITELKKTAVKRDQERKTMEDVVAQAQLVEFKGRPKKLENVFVRPAPDSKRVTGTLFIHQNGIRYQSPVRSDHRVDILFSNIKHLFFQPCKEELMVIIHCHLKTPLMIGKKKTFDVQFYREVSDVTVDETGNKKRRYRYGDEDELEQEQEERRRKALLDKEFRRFAEEISEASNGLLDLETPFRELGFTGVPFRSSVLCLPTRDCLIQLIDTPFLVVTLEEIEVAHLERVQFGLKNFDLVFVFKDFSKPVVHINTIPIEMLEFVKQWLTDVDIPYSEGAVNLNWGTIMKTIQADPYEFFENGGWSFLGGGESDDEESEEEESEFQVSDEDPEDEDVSEEYSAAEDGSDFSEEDDSEGSIAGSEDESEEEFSD

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 31 Entity 31 polymer

Description description	FACT complex subunit POB3
Molecular weight formula_weight	60292.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

GPGMSTVDFDTIFLNQSKAPGRFRITSSGLGWKPSSQVPTKGKTDPFLLPSGDILSVSWSRGYRGWELRVYTRNDKVIMLDGFEQQDFQQLKNEIQRTFNVNLEHKEHSLRGWNWGKTQLTRAELVFNVNNRPAWEIPYSEISNSNLTGRHEISMELNPKTVDENHYETLGDELVEVRLYVPGQIDKDEDSTEGQDTTEEAKSKSQLFYEQLKDKADFDTTSEAIVSFEDILFLTPRGRFEISMYANNLRLRGQSYDYKIQNKNVLRIFSLPRLDDRHHLVILQVDPPLRQGQTRYPFLVMQFDRNEELEVELNLSDEEYKSKYEGKLNRSYGTDSTYKILSHCLRGLTERRVITPGSFQSQHMQPGVNCSLKASEGQIYLLDKCLFFATKPCVYLPYSGIISVVTSRGTGQSTSRTFDIEVQFSGGSHTFANINKDEQKPIEDFLKGQGVRVKNEKPAEFLGNALVDDDDDSDDGDIAMGSAGEDDESVDEDFNAGSDSDVAEEYDSNAGSEDEDSDASSGEPEKKKPKH

Source Source

Source organism organism	Komagataella phaffii
NCBI taxonomy ID ncbi_taxonomy_id	460519
Host organism host_organism	Escherichia coli

Entity 32 Entity 32 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	38828

RNA polymerase II elongation complex transcribing a nucleosome (EC58oct)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II third largest subunit B44, part of central core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit B32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer