9ge5

CryoEM structure of the human INO80-Hexasome complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RuvB-like 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–453； UniProt 2–454 Author chain B； PDBConstruct 1–453； UniProt 2–454 Author chain C； PDBConstruct 1–453； UniProt 2–454

RuvB-like 2

Homo sapiens

UniProt Q9Y230

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–439； UniProt 15–453 Author chain E； PDBConstruct 1–439； UniProt 15–453 Author chain F； PDBConstruct 1–439； UniProt 15–453

Chromatin-remodeling ATPase INO80

Homo sapiens

UniProt Q9ULG1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INO80_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–733； UniProt 518–1250

INO80 complex subunit B

Homo sapiens

UniProt Q9C086

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IN80B_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–135； UniProt 208–342

INO80 complex subunit C

Homo sapiens

UniProt Q6PI98

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IN80C_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–107； UniProt 84–190

Actin-related protein 5

Homo sapiens

UniProt Q9H9F9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP5_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–576； UniProt 7–582

Histone H3.1

Homo sapiens

UniProt P68431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H31_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–94； UniProt 43–136 Author chain Q； PDBConstruct 1–94； UniProt 43–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H2A type 1-B/E × 1 （P04908） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	10, 11
Chains and sequence ranges	Author chain N； PDBConstruct 1–81； UniProt 23–103 Author chain R； PDBConstruct 1–78； UniProt 26–103

Histone H2A type 1-B/E

Homo sapiens

UniProt P04908

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2B type 1-B × 1 （P33778） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1B_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain S； PDBConstruct 1–108； UniProt 12–119

Histone H2B type 1-B

Homo sapiens

UniProt P33778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like 1 × 3 （Q9Y265） RuvB-like 2 × 3 （Q9Y230） Chromatin-remodeling ATPase INO80 × 1 （Q9ULG1） INO80 complex subunit B × 1 （Q9C086） INO80 complex subunit C × 1 （Q6PI98） Actin-related protein 5 × 1 （Q9H9F9） Hexasomal DNA Strand 1 × 1 Hexasomal DNA strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 1 （P62805） Histone H4 × 1 （P62805） Histone H2A type 1-B/E × 1 （P04908） ADENOSINE-5'-TRIPHOSPHATE × 1 ADENOSINE-5'-DIPHOSPHATE × 7 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1B_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain T； PDBConstruct 1–92； UniProt 33–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ge5
Deposition date deposition_date	2024-08-07
Structure title title	CryoEM structure of the human INO80-Hexasome complex
Keywords keywords	Homo sapiens, ATP-dependent chromatin remodeller, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ge5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ge5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ge5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.87 Å
Rg (electron density)	59.49 Å
Total Rg	59.73 Å
Atom count	40014
Residues	4695
Excluded volume	699390 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ge5__assembly_1__model_1`	18-meric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	RuvB-like 1
Molecular weight formula_weight	49905.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	40014

KIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKY

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	RuvB-like 2
Molecular weight formula_weight	48627.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

DVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Chromatin-remodeling ATPase INO80
Molecular weight formula_weight	85303.4 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LKGYQLKGMNWLANLYEQGINGILADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWGNPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALKSSSSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIESHAENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILMYCQLTSRQKLLYQALKNKISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPYHISKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAEMANLMLQGLLARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFPNLCSCPLLKSLVFSSHCKAVSGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAVPLDSYCNDRSAEYERRVLKEGGSLAAKQCLLNGAPELAADWLNRRSQFFPEPAGGLWSIRPQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYMVYRKHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVIS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	INO80 complex subunit B
Molecular weight formula_weight	14692.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

LTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQGSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	INO80 complex subunit C
Molecular weight formula_weight	12064.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

KDPNFVHSGHGGAVAGKKNRTWKYLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Actin-related protein 5
Molecular weight formula_weight	65589.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

PFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQFRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSMCSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Hexasomal DNA Strand 1
Molecular weight formula_weight	35098.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	K

ATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCG

Entity 8 Entity 8 polymer

Description description	Hexasomal DNA strand 2
Molecular weight formula_weight	34640.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	L

CGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATAT

Entity 9 Entity 9 polymer

Description description	Histone H3.1
Molecular weight formula_weight	10948.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,Q

RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Histone H4
Molecular weight formula_weight	9180.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Histone H4
Molecular weight formula_weight	8795.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Histone H2A type 1-B/E
Molecular weight formula_weight	11865.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 13 Entity 13 polymer

Description description	Histone H2B type 1-B
Molecular weight formula_weight	10263.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 14 Entity 14 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	3.350 Å
R factor r_factor	0.2245
R_work r_work	0.2245
R_free r_free	—

Resolution resolution	3.35 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	34444

CryoEM structure of the human INO80-Hexasome complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

RuvB-like 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin-remodeling ATPase INO80

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

INO80 complex subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

INO80 complex subunit C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A type 1-B/E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B type 1-B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer