SAXSdb — 6cgv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hexon protein

Human adenovirus C serotype 5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1260	Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 21	Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 105	Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 5 （P24937）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 126	Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 6 （P24937）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 21	Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 1260	Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSH_ADE05
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–949； UniProt 4–952 Author chain B； PDBConstruct 1–949； UniProt 4–952 Author chain C； PDBConstruct 1–949； UniProt 4–952 Author chain D； PDBConstruct 1–949； UniProt 4–952 Author chain E； PDBConstruct 1–949； UniProt 4–952 Author chain F； PDBConstruct 1–949； UniProt 4–952 Author chain G； PDBConstruct 1–949； UniProt 4–952 Author chain H； PDBConstruct 1–949； UniProt 4–952 Author chain I； PDBConstruct 1–949； UniProt 4–952 Author chain J； PDBConstruct 1–949； UniProt 4–952 Author chain K； PDBConstruct 1–949； UniProt 4–952 Author chain L； PDBConstruct 1–949； UniProt 4–952

Penton protein

Human adenovirus C serotype 5

UniProt P12538

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 105	Hexon protein × 60 （P04133） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 5 （P24937）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 126	Hexon protein × 72 （P04133） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 6 （P24937）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSP_ADE05
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain N； PDBConstruct 1–571； UniProt 1–571

Pre-hexon-linking protein IIIa

Human adenovirus C serotype 5

UniProt P12537

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 105	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 5 （P24937）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 126	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 6 （P24937）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP3_ADE05
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–585； UniProt 1–585

Hexon-interlacing protein

Human adenovirus C serotype 5

UniProt P03281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 105	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 5 （P24937）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 126	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 6 （P24937）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 1 （P24937）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 60 （P24937）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP9_ADE05
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain P； PDBConstruct 1–140； UniProt 1–140 Author chain Q； PDBConstruct 1–140； UniProt 1–140 Author chain R； PDBConstruct 1–140； UniProt 1–140 Author chain S； PDBConstruct 1–140； UniProt 1–140

Pre-hexon-linking protein VIII

Human adenovirus C serotype 5

UniProt P24936

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-protein VI × 60 （P24937）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-protein VI × 1 （P24937）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 105	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-protein VI × 5 （P24937）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 126	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-protein VI × 6 （P24937）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-protein VI × 1 （P24937）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-protein VI × 60 （P24937）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP8_ADE05
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain U； PDBConstruct 1–227； UniProt 1–227 Author chain V； PDBConstruct 1–227； UniProt 1–227

Pre-protein VI

Human adenovirus C serotype 5

UniProt P24937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 105	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 126	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 21	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 1260	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP6_ADE05
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain W； PDBConstruct 1–24； UniProt 6–29

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6cgv
Deposition date deposition_date	2018-02-21
Structure title title	Revised crystal structure of human adenovirus
Keywords keywords	Human adenovirus Crystal structure Ad5F35 Ad35F, VIRUS; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6cgv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6cgv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6cgv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	383.40 Å
Total Rg	383.50 Å
Atom count	5983380
Residues	750420
Excluded volume	105660000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6cgv__assembly_1__model_1`	1260-meric （1260）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6cgv__assembly_2__model_1`	21-meric （21）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`6cgv__assembly_3__model_1`	105-meric （105）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`6cgv__assembly_4__model_1`	126-meric （126）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`6cgv__assembly_5__model_1`	21-meric （21）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`6cgv__assembly_6__model_1`	1260-meric （1260）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Hexon protein
Molecular weight formula_weight	107804.2 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	99723

PSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNPTVAPTHDVTTDRSQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDMASTYFDIRGVLDRGPTFKPYSGTAYNALAPKGAPNPCEWDEAATALEINLEEEDDDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQIGVEGQTPKYADKTFQPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGSYAKPTNENGGQGILVKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVLYSEDVDIETPDTHISYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGLMYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYFSMWNQAVDSYDPDVRIIENHGTEDELPNYCFPLGGVINTETLTKVKPKTGQENGWEKDATEFSDKNEIRVGNNFAMEINLNANLWRNFLYSNIALYLPDKLKYSPSNVKISDNPNTYDYMNKRVVAPGLVDCYINLGARWSLDYMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMVLQSSLGNDLRVDGASIKFDSICLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYKDYQQVGILHQHNNSGFVGYLAPTMREGQAYPANFPYPLIGKTAVDSITQKKFLCDRTLWRIPFSSNFMSMGALTDLGQNLLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRVHRPHRGVIETVYLRTPFSAGNATT

Source Source

Source organism organism	Human adenovirus C serotype 5
Common name common_name	HAdV-5
NCBI taxonomy ID ncbi_taxonomy_id	28285
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Penton protein
Molecular weight formula_weight	63356.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSELAPLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEAFHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASLKDDTEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGIRSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNFPVVGAELLPVHSKSFYNDQAVYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQRVTITDARRRTCPYVYKALGIVSPRVLSSRTF

Source Source

Source organism organism	Human adenovirus C serotype 5
Common name common_name	HAdV-5
NCBI taxonomy ID ncbi_taxonomy_id	28285
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Pre-hexon-linking protein IIIa
Molecular weight formula_weight	65322.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMQDATDPAVRAALQSQPSGLNSTDDWRQVMDRIMSLTARNPDAFRQQPQANRLSAILEAVVPARANPTHEKVLAIVNALAENRAIRPDEAGLVYDALLQRVARYNSGNVQTNLDRLVGDVREAVAQRERAQQQGNLGSMVALNAFLSTQPANVPRGQEDYTNFVSALRLMVTETPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLQGLWGVRAPTGDRATVSSLLTPNSRLLLLLIAPFTDSGSVSRDTYLGHLLTLYREAIGQAHVDEHTFQEITSVSRALGQEDTGSLEATLNYLLTNRRQKIPSLHSLNSEEERILRYVQQSVSLNLMRDGVTPSVALDMTARNMEPGMYASNRPFINRLMDYLHRAAAVNPEYFTNAILNPHWLPPPGFYTGGFEVPEGNDGFLWDDIDDSVFSPQPQTLLELQQREQAEAALRKESFRRPSSLSDLGAAAPRSDASSPFPSLIGSLTSTRTTRPRLLGEEEYLNNSLLQPQREKNLPPAFPNNGIESLVDKMSRWKTYAQEHRDVPGPRPPTRRQRHDRQRGLVWEDDDSADDSSVLDLGGSGNPFAHLRPRLGRMF

Source Source

Source organism organism	Human adenovirus C serotype 5
Common name common_name	HAdV-5
NCBI taxonomy ID ncbi_taxonomy_id	28285
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Hexon-interlacing protein
Molecular weight formula_weight	14468.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,R,S

MSTNSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANSTTLTYETVSGTPLETAASAAASAAAATARGIVTDFAFLSPLASSAASRSSARDDKLTALLAQLDSLTRELNVVSQQLLDLRQQVSALKASSPPNAV

Source Source

Source organism organism	Human adenovirus C serotype 5
Common name common_name	HAdV-5
NCBI taxonomy ID ncbi_taxonomy_id	28285
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Pre-hexon-linking protein VIII
Molecular weight formula_weight	24710.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

MSKEIPTPYMWSYQPQMGLAAGAAQDYSTRINYMSAGPHMISRVNGIRAHRNRILLEQAAITTTPRNNLNPRSWPAALVYQESPAPTTVVLPRDAQAEVQMTNSGAQLAGGFRHRVRSPGQGITHLTIRGRGIQLNDESVSSSLGLRPDGTFQIGGAGRPSFTPRQAILTLQTSSSEPRSGGIGTLQFIEEFVPSVYFNPFSGPPGHYPDQFIPNFDAVKDSADGYD

Source Source

Source organism organism	Human adenovirus C serotype 5
Common name common_name	HAdV-5
NCBI taxonomy ID ncbi_taxonomy_id	28285
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Pre-protein VI
Molecular weight formula_weight	2649.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

FASLAPRHGSRPFMGNWQDIGTSN

Source Source

Source organism organism	Human adenovirus C serotype 5
Common name common_name	HAdV-5
NCBI taxonomy ID ncbi_taxonomy_id	28285
Host organism host_organism	Homo sapiens

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	6cgvM01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1500 — Pre-hexon-linking protein IIIa

▶

Unit-cell length a length_a	854.245 Å
Unit-cell length b length_b	855.315 Å
Unit-cell length c length_c	865.907 Å
Unit-cell angle α angle_alpha	60.38 °
Unit-cell angle β angle_beta	60.43 °
Unit-cell angle γ angle_gamma	61.98 °
Molecules per unit cell Z z_pdb	720

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	129.000 Å
R factor r_factor	—
R_work r_work	0.4220
R_free r_free	0.4270

Revised crystal structure of human adenovirus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hexon protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Penton protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein IIIa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hexon-interlacing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-protein VI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6cgv__assembly_1__model_1

6cgv__assembly_1__model_1 | I(q)

6cgv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 1 domains