7s78

Structure of a cell-entry defective human adenovirus provides insights into precursor proteins and capsid maturation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hexon protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1860	Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 540 （P24937） Unknown-1 × 60 Unknown-2 × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 31	Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 155	Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 45 （P24937） Unknown-1 × 5 Unknown-2 × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 186	Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 54 （P24937） Unknown-1 × 6 Unknown-2 × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 31	Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSH_ADE05
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–952； UniProt 1–952 Author chain B； PDBConstruct 1–952； UniProt 1–952 Author chain C； PDBConstruct 1–952； UniProt 1–952 Author chain D； PDBConstruct 1–952； UniProt 1–952 Author chain E； PDBConstruct 1–952； UniProt 1–952 Author chain F； PDBConstruct 1–952； UniProt 1–952 Author chain G； PDBConstruct 1–952； UniProt 1–952 Author chain H； PDBConstruct 1–952； UniProt 1–952 Author chain I； PDBConstruct 1–952； UniProt 1–952 Author chain J； PDBConstruct 1–952； UniProt 1–952 Author chain K； PDBConstruct 1–952； UniProt 1–952 Author chain L； PDBConstruct 1–952； UniProt 1–952

Penton protein

OrganismNot specified

UniProt P12538

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1860	Hexon protein × 720 （P04133） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 540 （P24937） Unknown-1 × 60 Unknown-2 × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 155	Hexon protein × 60 （P04133） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 45 （P24937） Unknown-1 × 5 Unknown-2 × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 186	Hexon protein × 72 （P04133） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 54 （P24937） Unknown-1 × 6 Unknown-2 × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSP_ADE05
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain N； PDBConstruct 1–571； UniProt 1–571

Pre-hexon-linking protein IIIa

OrganismNot specified

UniProt P12537

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1860	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 540 （P24937） Unknown-1 × 60 Unknown-2 × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 155	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 45 （P24937） Unknown-1 × 5 Unknown-2 × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 186	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 54 （P24937） Unknown-1 × 6 Unknown-2 × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP3_ADE05
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–585； UniProt 1–585

Hexon-interlacing protein

OrganismNot specified

UniProt P03281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1860	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Pre-hexon-linking protein VIII × 120 （P24936） Pre-protein VI × 540 （P24937） Unknown-1 × 60 Unknown-2 × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 155	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Pre-hexon-linking protein VIII × 10 （P24936） Pre-protein VI × 45 （P24937） Unknown-1 × 5 Unknown-2 × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 186	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Pre-hexon-linking protein VIII × 12 （P24936） Pre-protein VI × 54 （P24937） Unknown-1 × 6 Unknown-2 × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Pre-hexon-linking protein VIII × 2 （P24936） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP9_ADE05
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain P； PDBConstruct 1–140； UniProt 1–140 Author chain Q； PDBConstruct 1–140； UniProt 1–140 Author chain R； PDBConstruct 1–140； UniProt 1–140 Author chain S； PDBConstruct 1–140； UniProt 1–140

Pre-hexon-linking protein VIII

OrganismNot specified

UniProt P24936

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1860	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-protein VI × 540 （P24937） Unknown-1 × 60 Unknown-2 × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 155	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-protein VI × 45 （P24937） Unknown-1 × 5 Unknown-2 × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 186	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-protein VI × 54 （P24937） Unknown-1 × 6 Unknown-2 × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-protein VI × 9 （P24937） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP8_ADE05
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain U； PDBConstruct 1–227； UniProt 1–227 Author chain V； PDBConstruct 1–227； UniProt 1–227

Pre-protein VI

OrganismNot specified

UniProt P24937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1860	Hexon protein × 720 （P04133） Penton protein × 60 （P12538） Pre-hexon-linking protein IIIa × 60 （P12537） Hexon-interlacing protein × 240 （P03281） Pre-hexon-linking protein VIII × 120 （P24936） Unknown-1 × 60 Unknown-2 × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 155	Hexon protein × 60 （P04133） Penton protein × 5 （P12538） Pre-hexon-linking protein IIIa × 5 （P12537） Hexon-interlacing protein × 20 （P03281） Pre-hexon-linking protein VIII × 10 （P24936） Unknown-1 × 5 Unknown-2 × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 186	Hexon protein × 72 （P04133） Penton protein × 6 （P12538） Pre-hexon-linking protein IIIa × 6 （P12537） Hexon-interlacing protein × 24 （P03281） Pre-hexon-linking protein VIII × 12 （P24936） Unknown-1 × 6 Unknown-2 × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 31	Hexon protein × 12 （P04133） Penton protein × 1 （P12538） Pre-hexon-linking protein IIIa × 1 （P12537） Hexon-interlacing protein × 4 （P03281） Pre-hexon-linking protein VIII × 2 （P24936） Unknown-1 × 1 Unknown-2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAP6_ADE05
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 0； PDBConstruct 1–250； UniProt 1–250 Author chain 1； PDBConstruct 1–250； UniProt 1–250 Author chain 2； PDBConstruct 1–250； UniProt 1–250 Author chain 3； PDBConstruct 1–250； UniProt 1–250 Author chain 4； PDBConstruct 1–250； UniProt 1–250 Author chain W； PDBConstruct 1–250； UniProt 1–250 Author chain X； PDBConstruct 1–250； UniProt 1–250 Author chain Y； PDBConstruct 1–250； UniProt 1–250 Author chain Z； PDBConstruct 1–250； UniProt 1–250

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s78
Deposition date deposition_date	2021-09-15
Structure title title	Structure of a cell-entry defective human adenovirus provides insights into precursor proteins and capsid maturation
Keywords keywords	Adenovirus, ts1 mutant, minor protein precursors, virus maturation, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7s78__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7s78__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7s78__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	384.40 Å
Total Rg	384.50 Å
Atom count	6282840
Residues	790920
Excluded volume	110900000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7s78__assembly_1__model_1`	1860-meric （1860）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7s78__assembly_2__model_1`	31-meric （31）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`7s78__assembly_3__model_1`	155-meric （155）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`7s78__assembly_4__model_1`	186-meric （186）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`7s78__assembly_5__model_1`	31-meric （31）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Hexon protein
Molecular weight formula_weight	108107.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	104715

MATPSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNPTVAPTHDVTTDRSQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDMASTYFDIRGVLDRGPTFKPYSGTAYNALAPKGAPNPCEWDEAATALEINLEEEDDDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQIGVEGQTPKYADKTFQPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGSYAKPTNENGGQGILVKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVLYSEDVDIETPDTHISYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGLMYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYFSMWNQAVDSYDPDVRIIENHGTEDELPNYCFPLGGVINTETLTKVKPKTGQENGWEKDATEFSDKNEIRVGNNFAMEINLNANLWRNFLYSNIALYLPDKLKYSPSNVKISDNPNTYDYMNKRVVAPGLVDCYINLGARWSLDYMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMVLQSSLGNDLRVDGASIKFDSICLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYKDYQQVGILHQHNNSGFVGYLAPTMREGQAYPANFPYPLIGKTAVDSITQKKFLCDRTLWRIPFSSNFMSMGALTDLGQNLLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRVHRPHRGVIETVYLRTPFSAGNATT

Entity 2 Entity 2 polymer

Description description	Penton protein
Molecular weight formula_weight	63356.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSELAPLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEAFHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASLKDDTEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGIRSWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTRQISNFPVVGAELLPVHSKSFYNDQAVYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQRVTITDARRRTCPYVYKALGIVSPRVLSSRTF

Entity 3 Entity 3 polymer

Description description	Pre-hexon-linking protein IIIa
Molecular weight formula_weight	65322.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MMQDATDPAVRAALQSQPSGLNSTDDWRQVMDRIMSLTARNPDAFRQQPQANRLSAILEAVVPARANPTHEKVLAIVNALAENRAIRPDEAGLVYDALLQRVARYNSGNVQTNLDRLVGDVREAVAQRERAQQQGNLGSMVALNAFLSTQPANVPRGQEDYTNFVSALRLMVTETPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLQGLWGVRAPTGDRATVSSLLTPNSRLLLLLIAPFTDSGSVSRDTYLGHLLTLYREAIGQAHVDEHTFQEITSVSRALGQEDTGSLEATLNYLLTNRRQKIPSLHSLNSEEERILRYVQQSVSLNLMRDGVTPSVALDMTARNMEPGMYASNRPFINRLMDYLHRAAAVNPEYFTNAILNPHWLPPPGFYTGGFEVPEGNDGFLWDDIDDSVFSPQPQTLLELQQREQAEAALRKESFRRPSSLSDLGAAAPRSDASSPFPSLIGSLTSTRTTRPRLLGEEEYLNNSLLQPQREKNLPPAFPNNGIESLVDKMSRWKTYAQEHRDVPGPRPPTRRQRHDRQRGLVWEDDDSADDSSVLDLGGSGNPFAHLRPRLGRMF

Entity 4 Entity 4 polymer

Description description	Hexon-interlacing protein
Molecular weight formula_weight	14468.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,R,S

MSTNSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANSTTLTYETVSGTPLETAASAAASAAAATARGIVTDFAFLSPLASSAASRSSARDDKLTALLAQLDSLTRELNVVSQQLLDLRQQVSALKASSPPNAV

Entity 5 Entity 5 polymer

Description description	Pre-hexon-linking protein VIII
Molecular weight formula_weight	24710.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

MSKEIPTPYMWSYQPQMGLAAGAAQDYSTRINYMSAGPHMISRVNGIRAHRNRILLEQAAITTTPRNNLNPRSWPAALVYQESPAPTTVVLPRDAQAEVQMTNSGAQLAGGFRHRVRSPGQGITHLTIRGRGIQLNDESVSSSLGLRPDGTFQIGGAGRPSFTPRQAILTLQTSSSEPRSGGIGTLQFIEEFVPSVYFNPFSGPPGHYPDQFIPNFDAVKDSADGYD

Entity 6 Entity 6 polymer

Description description	Pre-protein VI
Molecular weight formula_weight	27027.5 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X,Y,Z,0,1,2,3,4

MEDINFASLAPRHGSRPFMGNWQDIGTSNMSGGAFSWGSLWSGIKNFGSTVKNYGSKAWNSSTGQMLRDKLKEQNFQQKVVDGLASGISGVVDLANQAVQNKINSKLDPRPPVEEPPPAVETVSPEGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLPTTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPTAVVVTRPSRASLRRAASGPRSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF

Entity 7 Entity 7 polymer

Description description	Unknown-1
Molecular weight formula_weight	1379.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

XXXXXXXXXXXXXXXX

Entity 8 Entity 8 polymer

Description description	Unknown-2
Molecular weight formula_weight	869.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

XXXXXXXXXX

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.72 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11277

Structure of a cell-entry defective human adenovirus provides insights into precursor proteins and capsid maturation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hexon protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Penton protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein IIIa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hexon-interlacing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-hexon-linking protein VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-protein VI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s78__assembly_1__model_1

7s78__assembly_1__model_1 | I(q)

7s78__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

7. Citations (1)