6fiz

Crystal Structure of CNG mimicking NaK-EAPP mutant (T67A) cocrystallized with K+

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein

Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 4	GLYCINE × 10 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 1 water × 4	Consistent with protein count
2	Insufficient information	Homooligomer	Protein 4	GLYCINE × 12 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 4	Consistent with protein count
3	Insufficient information	Homooligomer	Protein 4	GLYCINE × 17 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 4	Consistent with protein count
4	Insufficient information	Homooligomer	Protein 4	GLYCINE × 21 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CNGA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 47–52； UniProt 339–344 Author chain B； PDBConstruct 47–52； UniProt 339–344 Author chain C； PDBConstruct 47–52； UniProt 339–344 Author chain D； PDBConstruct 47–52； UniProt 339–344 Author chain E； PDBConstruct 47–52； UniProt 339–344 Author chain F； PDBConstruct 47–52； UniProt 339–344 Author chain G； PDBConstruct 47–52； UniProt 339–344 Author chain H； PDBConstruct 47–52； UniProt 339–344 Author chain I； PDBConstruct 47–52； UniProt 339–344 Author chain J； PDBConstruct 47–52； UniProt 339–344 Author chain K； PDBConstruct 47–52； UniProt 339–344 Author chain L； PDBConstruct 47–52； UniProt 339–344 Author chain M； PDBConstruct 47–52； UniProt 339–344 Author chain N； PDBConstruct 47–52； UniProt 339–344 Author chain O； PDBConstruct 47–52； UniProt 339–344 Author chain P； PDBConstruct 47–52； UniProt 339–344

Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein

Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)

UniProt Q81HW2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 4	GLYCINE × 10 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 1 water × 4	Consistent with protein count
2	Insufficient information	Homooligomer	Protein 4	GLYCINE × 12 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 4	Consistent with protein count
3	Insufficient information	Homooligomer	Protein 4	GLYCINE × 17 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 4	Consistent with protein count
4	Insufficient information	Homooligomer	Protein 4	GLYCINE × 21 POTASSIUM ION × 3 (4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q81HW2_BACCR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–46； UniProt 20–64 Author chain A； PDBConstruct 53–91； UniProt 72–110 Author chain B； PDBConstruct 2–46； UniProt 20–64 Author chain B； PDBConstruct 53–91； UniProt 72–110 Author chain C； PDBConstruct 2–46； UniProt 20–64 Author chain C； PDBConstruct 53–91； UniProt 72–110 Author chain D； PDBConstruct 2–46； UniProt 20–64 Author chain D； PDBConstruct 53–91； UniProt 72–110 Author chain E； PDBConstruct 2–46； UniProt 20–64 Author chain E； PDBConstruct 53–91； UniProt 72–110 Author chain F； PDBConstruct 2–46； UniProt 20–64 Author chain F； PDBConstruct 53–91； UniProt 72–110 Author chain G； PDBConstruct 2–46； UniProt 20–64 Author chain G； PDBConstruct 53–91； UniProt 72–110 Author chain H； PDBConstruct 2–46； UniProt 20–64 Author chain H； PDBConstruct 53–91； UniProt 72–110 Author chain I； PDBConstruct 2–46； UniProt 20–64 Author chain I； PDBConstruct 53–91； UniProt 72–110 Author chain J； PDBConstruct 2–46； UniProt 20–64 Author chain J； PDBConstruct 53–91； UniProt 72–110 Author chain K； PDBConstruct 2–46； UniProt 20–64 Author chain K； PDBConstruct 53–91； UniProt 72–110 Author chain L； PDBConstruct 2–46； UniProt 20–64 Author chain L； PDBConstruct 53–91； UniProt 72–110 Author chain M； PDBConstruct 2–46； UniProt 20–64 Author chain M； PDBConstruct 53–91； UniProt 72–110 Author chain N； PDBConstruct 2–46； UniProt 20–64 Author chain N； PDBConstruct 53–91； UniProt 72–110 Author chain O； PDBConstruct 2–46； UniProt 20–64 Author chain O； PDBConstruct 53–91； UniProt 72–110 Author chain P； PDBConstruct 2–46； UniProt 20–64 Author chain P； PDBConstruct 53–91； UniProt 72–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6fiz
Deposition date deposition_date	2018-01-19
Structure title title	Crystal Structure of CNG mimicking NaK-EAPP mutant (T67A) cocrystallized with K+
Keywords keywords	CNG mimick, ion channel, transport channel, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6fiz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6fiz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6fiz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.54 Å
Rg (electron density)	20.35 Å
Total Rg	21.52 Å
Atom count	2893
Residues	364
Excluded volume	53887 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6fiz__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6fiz__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6fiz__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6fiz__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein
Molecular weight formula_weight	10294.1 kDa
Source method src_method	man
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
Atom count atom_count	11844

AKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGEAPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNVVP

Source Source

Source organism organism	Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
NCBI taxonomy ID ncbi_taxonomy_id	226900
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	GLYCINE
Molecular weight formula_weight	75.1 kDa
Source method src_method	syn
Copy count entity_count	60

Entity 3 Entity 3 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 4 Entity 4 non-polymer

Description description	(4S)-2-METHYL-2,4-PENTANEDIOL
Molecular weight formula_weight	118.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	95

▼

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

Domain ID domain_id	6fizA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizM00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizN00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizO00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6fizP00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

▶

Unit-cell length a length_a	181.220 Å
Unit-cell length b length_b	135.250 Å
Unit-cell length c length_c	67.430 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.95 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	64

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.630 Å
Low-resolution limit resolution_low	67.620 Å
R factor r_factor	0.2371
R_work r_work	0.2353
R_free r_free	0.2693

Crystal Structure of CNG mimicking NaK-EAPP mutant (T67A) cocrystallized with K+

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein

State in the Current Structure

Other States of the Same Protein in the Database

Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6fiz__assembly_1__model_1

6fiz__assembly_1__model_1 | I(q)

6fiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)

Crystal Structure of CNG mimicking NaK-EAPP mutant (T67A) cocrystallized with K+

1. Protein Identity and Related Structures Protein Identity & Related Structures

Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Potassium channel protein,Cyclic nucleotide-gated olfactory channel,Potassium channel protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6fiz__assembly_1__model_1

6fiz__assembly_1__model_1 | I(q)

6fiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)