SAXSdb — 6hkp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypoxia-inducible factor 1-alpha inhibitor

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Apoptosis-stimulating of p53 protein 2 × 2 （Q13625） SULFATE ION × 12 GLYCEROL × 10 N-OXALYLGLYCINE × 2 ZINC ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HIF1N_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–350； UniProt 1–349

Apoptosis-stimulating of p53 protein 2

OrganismNot specified

UniProt Q13625

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Hypoxia-inducible factor 1-alpha inhibitor × 2 （Q9NWT6） SULFATE ION × 12 GLYCEROL × 10 N-OXALYLGLYCINE × 2 ZINC ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ASPP2_HUMAN
Isoform	Q13625-3
PDB entities	2
Chains and sequence ranges	Author chain S； PDBConstruct 1–23； UniProt 976–998

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hkp
Deposition date deposition_date	2018-09-07
Structure title title	Factor Inhibiting HIF (FIH) in complex with zinc, NOG and ASPP2 (970-992)
Keywords keywords	;NON-HEME, DIOXYGENASE, OXYGENASE, METAL-BINDING, TRANSCRIPTION, DOUBLE STRANDED BETA-HELIX, DSBH, FACIAL TRIAD, ASPARAGINYL/ASPARTYL HYDROXYLASE, EPIGENETIC REGULATION, SIGNALING, ARD, BETA-HYDROXYLATION, ACTIVATOR-INHIBITOR, OXIDOREDUCTASE-PEPTIDE COMPLEX, OXIDOREDUCTASE, ANKYRIN REPEAT DOMAIN, APOPTOSIS, P53 BINDING PROTEIN, ANK REPEAT, SH3 DOMAIN, ANKYRIN REPEATS, GENE REGULATION ;; GENE REGULATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hkp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hkp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hkp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.36 Å
Rg (electron density)	34.20 Å
Total Rg	34.57 Å
Atom count	5722
Residues	704
Excluded volume	101000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hkp__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Hypoxia-inducible factor 1-alpha inhibitor
Molecular weight formula_weight	40415.4 kDa
EC 编号 ec_number	1.14.11.30,1.14.11.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3055

SMAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Apoptosis-stimulating of p53 protein 2
Molecular weight formula_weight	2419.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

GHTEIVKFLVQFGVNVNAADSDG

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 non-polymer

Description description	N-OXALYLGLYCINE
Molecular weight formula_weight	147.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	177

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	6hkpA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	10 — Jelly Rolls

Domain ID domain_id	6hkpA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1010 — Clavaminate synthase-like

▶

Unit-cell length a length_a	86.020 Å
Unit-cell length b length_b	86.020 Å
Unit-cell length c length_c	148.508 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	56.287 Å
R factor r_factor	0.1765
R_work r_work	0.1755
R_free r_free	0.1948

Factor Inhibiting HIF (FIH) in complex with zinc, NOG and ASPP2 (970-992)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypoxia-inducible factor 1-alpha inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

Apoptosis-stimulating of p53 protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hkp__assembly_1__model_1

6hkp__assembly_1__model_1 | I(q)

6hkp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Factor Inhibiting HIF (FIH) in complex with zinc, NOG and ASPP2 (970-992)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypoxia-inducible factor 1-alpha inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Apoptosis-stimulating of p53 protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hkp__assembly_1__model_1

6hkp__assembly_1__model_1 | I(q)

6hkp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)