SAXSdb — 6w1x

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy1

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 1	Type I-F CRISPR-associated protein Csy2 × 1 （B3G161） CRISPR-associated protein Csy3 × 6 （A0A444M080） RNA (60-MER) × 1 CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） anti-CRISPR AcrIF9 × 2 （C0AVY5）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSY1_PSEAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–434； UniProt 1–434

Type I-F CRISPR-associated protein Csy2

Pseudomonas aeruginosa

UniProt B3G161

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） CRISPR-associated protein Csy3 × 6 （A0A444M080） RNA (60-MER) × 1 CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） anti-CRISPR AcrIF9 × 2 （C0AVY5）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B3G161_PSEAI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–327； UniProt 1–327

CRISPR-associated protein Csy3

Pseudomonas aeruginosa

UniProt A0A444M080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） Type I-F CRISPR-associated protein Csy2 × 1 （B3G161） RNA (60-MER) × 1 CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） anti-CRISPR AcrIF9 × 2 （C0AVY5）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A444M080_PSEAI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 20–360； UniProt 2–342 Author chain D； PDBConstruct 20–360； UniProt 2–342 Author chain E； PDBConstruct 20–360； UniProt 2–342 Author chain F； PDBConstruct 20–360； UniProt 2–342 Author chain G； PDBConstruct 20–360； UniProt 2–342 Author chain H； PDBConstruct 20–360； UniProt 2–342

CRISPR-associated endonuclease Cas6/Csy4

Pseudomonas aeruginosa

UniProt Q02MM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） Type I-F CRISPR-associated protein Csy2 × 1 （B3G161） CRISPR-associated protein Csy3 × 6 （A0A444M080） RNA (60-MER) × 1 anti-CRISPR AcrIF9 × 2 （C0AVY5）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAS6_PSEAB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–187； UniProt 1–187

anti-CRISPR AcrIF9

Proteus penneri

UniProt C0AVY5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 11 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） Type I-F CRISPR-associated protein Csy2 × 1 （B3G161） CRISPR-associated protein Csy3 × 6 （A0A444M080） RNA (60-MER) × 1 CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C0AVY5_9GAMM
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain I； PDBConstruct 1–68； UniProt 1–68 Author chain J； PDBConstruct 1–68； UniProt 1–68

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6w1x
Deposition date deposition_date	2020-03-04
Structure title title	Cryo-EM structure of anti-CRISPR AcrIF9, bound to the type I-F crRNA-guided CRISPR surveillance complex
Keywords keywords	type I-F CRISPR RNA-guided surveillance complex, Csy complex, IMMUNE SYSTEM-RNA complex; IMMUNE SYSTEM/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6w1x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6w1x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6w1x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.69 Å
Rg (electron density)	48.13 Å
Total Rg	48.29 Å
Atom count	21735
Residues	2934
Excluded volume	376080 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6w1x__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	CRISPR-associated protein Csy1
Molecular weight formula_weight	49194.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	21735

MTSPLPTPTWQELRQFIESFIQERLQGKLDKLQPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGSNLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEALQALSDNAEQAREWRQAFIGITTVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAAREARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNNERRGENWLLPSLPPNWQRQNVNAPMRHSSVFEHDFGRTPEVSRLTRTLQRFLAKTVHNNLAIRQRRAQLVAQICDEALQYAARLRELEPGWSATPGCQLHDAEQLWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILEDERD

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Type I-F CRISPR-associated protein Csy2
Molecular weight formula_weight	36244.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSVTDPEALLLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRVGISLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQEQAGAMRLAGGSILPWCNERFPAPNAELLMLGGSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETLRTTLPEATTLDALLDLCRINFEPPATSSEEEASPPDAAWQVRDKPGWLVPIPAGYNALSPLYLPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLWYHHAEPDKGLYRWSTPRFVEHAIA

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	CRISPR-associated protein Csy3
Molecular weight formula_weight	39778.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F,G,H

MKSSHHHHHHENLYFQSNASKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	RNA (60-MER)
Molecular weight formula_weight	19265.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

CUAAGAAAUUCACGGCGGGCUUGAUGUCCGCGUCUACCUGGUUCACUGCCGUGUAGGCAG

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	CRISPR-associated endonuclease Cas6/Csy4
Molecular weight formula_weight	21427.5 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	anti-CRISPR AcrIF9
Molecular weight formula_weight	7863.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MKSTYIIKEVQNINSDREGVKVETTSLTSAKRIASKNQFFHGTVLRIESESGNWLAYKEDGKRWIECE

Source Source

Source organism organism	Proteus penneri
NCBI taxonomy ID ncbi_taxonomy_id	102862
Host organism host_organism	Escherichia coli

▶

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	285707

Cryo-EM structure of anti-CRISPR AcrIF9, bound to the type I-F crRNA-guided CRISPR surveillance complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type I-F CRISPR-associated protein Csy2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated protein Csy3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated endonuclease Cas6/Csy4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

anti-CRISPR AcrIF9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6w1x__assembly_1__model_1

6w1x__assembly_1__model_1 | I(q)

6w1x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)