SAXSdb — 6wc2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

Homo sapiens

UniProt Q02078

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3 DNA 2	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952） water × 5	Consistent with all polymers
2	Insufficient information	Heteromer	Protein 3 DNA 2	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952） water × 5	Consistent with all polymers
3	Insufficient information	Heteromer	Protein 3 DNA 2	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952） water × 5	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MEF2A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–72； UniProt 1–72 Author chain A； PDBConstruct 92–95； UniProt 92–95 Author chain B； PDBConstruct 1–72； UniProt 1–72 Author chain B； PDBConstruct 92–95； UniProt 92–95 Author chain C； PDBConstruct 1–72； UniProt 1–72 Author chain C； PDBConstruct 92–95； UniProt 92–95 Author chain D； PDBConstruct 1–72； UniProt 1–72 Author chain D； PDBConstruct 92–95； UniProt 92–95 Author chain I； PDBConstruct 1–72； UniProt 1–72 Author chain I； PDBConstruct 92–95； UniProt 92–95 Author chain J； PDBConstruct 1–72； UniProt 1–72 Author chain J； PDBConstruct 92–95； UniProt 92–95

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

Homo sapiens

UniProt Q02080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3 DNA 2	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952） water × 5	Consistent with all polymers
2	Insufficient information	Heteromer	Protein 3 DNA 2	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952） water × 5	Consistent with all polymers
3	Insufficient information	Heteromer	Protein 3 DNA 2	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952） water × 5	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MEF2B_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 73–91； UniProt 73–91 Author chain B； PDBConstruct 73–91； UniProt 73–91 Author chain C； PDBConstruct 73–91； UniProt 73–91 Author chain D； PDBConstruct 73–91； UniProt 73–91 Author chain I； PDBConstruct 73–91； UniProt 73–91 Author chain J； PDBConstruct 73–91； UniProt 73–91

Homeobox protein Nkx-2.5

Homo sapiens

UniProt P52952

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3 DNA 2	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A × 2 （Q02078,Q02080） Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 water × 5	Consistent with all polymers
2	Insufficient information	Heteromer	Protein 3 DNA 2	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A × 2 （Q02078,Q02080） Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 water × 5	Consistent with all polymers
3	Insufficient information	Heteromer	Protein 3 DNA 2	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A × 2 （Q02078,Q02080） Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 water × 5	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NKX25_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain M； PDBConstruct 1–61； UniProt 137–197 Author chain N； PDBConstruct 1–61； UniProt 137–197 Author chain O； PDBConstruct 1–61； UniProt 137–197

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6wc2
Deposition date deposition_date	2020-03-29
Structure title title	Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
Keywords keywords	Transcription Factor, DNA binding Protein, Cardiogenesis, Carcinogenesis, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6wc2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6wc2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6wc2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.78 Å
Rg (electron density)	23.22 Å
Total Rg	23.85 Å
Atom count	2808
Residues	274
Excluded volume	47615 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6wc2__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6wc2__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6wc2__assembly_3__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A
Molecular weight formula_weight	11343.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,I,J
Atom count atom_count	8973

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYSEPHESRTNTDILETLKRREHRG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Myocardin Enhancer DNA
Molecular weight formula_weight	6445.2 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E,G,K

AAGCACTTTCTTAAAATAGTG

Entity 3 Entity 3 polymer

Description description	Myocardin Enhancer DNA
Molecular weight formula_weight	6436.2 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F,H,L

CACTATTTTAAGAAAGTGCTT

Entity 4 Entity 4 polymer

Description description	Homeobox protein Nkx-2.5
Molecular weight formula_weight	7671.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O

RRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSKRQR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	445

▶

Unit-cell length a length_a	69.370 Å
Unit-cell length b length_b	133.900 Å
Unit-cell length c length_c	140.040 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	70.120 Å
R factor r_factor	0.1876
R_work r_work	0.1857
R_free r_free	0.2247

Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

State in the Current Structure

Other States of the Same Protein in the Database

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

State in the Current Structure

Other States of the Same Protein in the Database

Homeobox protein Nkx-2.5

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6wc2__assembly_1__model_1

6wc2__assembly_1__model_1 | I(q)

6wc2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 water

7. Citations (1)

Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Homeobox protein Nkx-2.5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6wc2__assembly_1__model_1

6wc2__assembly_1__model_1 | I(q)

6wc2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 water

7. Citations (1)