SAXSdb — 6xzq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase acidic protein

Influenza C virus (strain C/Johannesburg/1/1966)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	;RNA (5'-R(APGPUPAPGPAPAPAPCPAPAPGPGPGPCPCPCPUP*G)-3') ; × 1 RNA-directed RNA polymerase catalytic subunit × 2 （Q9IMP4） Polymerase basic protein 2 × 2 （Q9IMP3） Acidic leucine-rich nuclear phosphoprotein 32 family member A × 1 （P39687）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PA_INCJH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–709； UniProt 1–709 Author chain D； PDBConstruct 1–709； UniProt 1–709

RNA-directed RNA polymerase catalytic subunit

Influenza C virus (strain C/Johannesburg/1/1966)

UniProt Q9IMP4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	;RNA (5'-R(APGPUPAPGPAPAPAPCPAPAPGPGPGPCPCPCPUP*G)-3') ; × 1 Polymerase acidic protein × 2 （Q9IMP5） Polymerase basic protein 2 × 2 （Q9IMP3） Acidic leucine-rich nuclear phosphoprotein 32 family member A × 1 （P39687）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RDRP_INCJH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–754； UniProt 1–754 Author chain E； PDBConstruct 1–754； UniProt 1–754

Polymerase basic protein 2

Influenza C virus (strain C/Johannesburg/1/1966)

UniProt Q9IMP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	;RNA (5'-R(APGPUPAPGPAPAPAPCPAPAPGPGPGPCPCPCPUP*G)-3') ; × 1 Polymerase acidic protein × 2 （Q9IMP5） RNA-directed RNA polymerase catalytic subunit × 2 （Q9IMP4） Acidic leucine-rich nuclear phosphoprotein 32 family member A × 1 （P39687）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PB2_INCJH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–774； UniProt 1–774 Author chain F； PDBConstruct 1–774； UniProt 1–774

Acidic leucine-rich nuclear phosphoprotein 32 family member A

Homo sapiens

UniProt P39687

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	;RNA (5'-R(APGPUPAPGPAPAPAPCPAPAPGPGPGPCPCPCPUP*G)-3') ; × 1 Polymerase acidic protein × 2 （Q9IMP5） RNA-directed RNA polymerase catalytic subunit × 2 （Q9IMP4） Polymerase basic protein 2 × 2 （Q9IMP3）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AN32A_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 15–263； UniProt 1–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6xzq
Deposition date deposition_date	2020-02-05
Structure title title	Influenza C virus polymerase in complex with human ANP32A - Subclass 1
Keywords keywords	Influenza Polymerase, ANP32, replication, RNA-dependent RNA polymerase, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6xzq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6xzq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6xzq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.81 Å
Rg (electron density)	52.56 Å
Total Rg	52.73 Å
Atom count	56888
Residues	3511
Excluded volume	508310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6xzq__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	;RNA (5'-R(APGPUPAPGPAPAPAPCPAPAPGPGPGPCPCPCPUP*G)-3') ;
Molecular weight formula_weight	14901.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	I
Atom count atom_count	56888

AGUAGAAACAAGGGUAUUUUUCUUUACUAGUCUACCCUGCUUUUGCU

Entity 2 Entity 2 polymer

Description description	Polymerase acidic protein
Molecular weight formula_weight	82025.5 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D

MSKTFAEIAEAFLEPEAVRIAKEAVEEYGDHERKIIQIGIHFQVCCMFCDEYLSTNGSDRFVLIEGRKRGTAVSLQNELCKSYDLEPLPFLCDIFDREEKQFVEIGITRKADDSYFQSKFGKLGNSCKIFVFSYDGRLDKNCEGPMEEQKLRIFSFLATAADFLRKENMFNEIFLPDNEETIIEMKKGKTFLELRDESVPLPFQTYEQMKDYCEKFKGNPRELASKVSQMQSNIKLPIKHYEQNKFRQIRLPKGPMAPYTHKFLMEEAWMFTKISDPERSRAGEILIDFFKKGNLSAIRPKDKPLQGKYPIHYKNLWNQIKAAIADRTMVINENDHSEFLGGIGRASKKIPEISLTQDVITTEGLKQSENKLPEPRSFPRWFNAEWMWAIKDSDLTGWVPMAEYPPADNELEDYAEHLNKTMEGVLQGTNCAREMGKCILTVGALMTECRLFPGKIKVVPIYARSKERKSMQEGLPVPSEMDCLFGICVKSKSHLNKDDGMYTIITFEFSIREPNLEKHQKYTVFEAGHTTVRMKKGESVIGREVPLYLYCRTTALSKIKNDWLSKARRCFITTMDTVETICLRESAKAEENLVEKTLNEKQMWIGKKNGELIAQPLREALRVQLVQQFYFCIYNDSQLEGFCNEQKKILMALEGDKKNKSSFGFNPEGLLEKIEECLINNPMCLFMAQRLNELVIEASKRGAKFFKTD

Source Source

Source organism organism	Influenza C virus (strain C/Johannesburg/1/1966)
NCBI taxonomy ID ncbi_taxonomy_id	100673
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	RNA-directed RNA polymerase catalytic subunit
Molecular weight formula_weight	86145.9 kDa
EC 编号 ec_number	2.7.7.48
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E

MEINPYLMFLNNDVTSLISTTYPYTGPPPMSHGSSTKYTLETIKRTYDYSRTSVEKTSKVFNIPRRKFCNCLEDKDELVKPTGNVDISSLLGLAEMMEKRMGEGFFKHCVMEAETEILKMHFSRLTEGRQTYDWTSERNMPAATALQLTVDAIKETEGPFKGTTMLEYCNKMIEMLDWKEIKFKKVKTVVRREKDKRSGKEIKTKVPVMGIDSIKHDEFLIRALTINTMAKDGERGKLQRRAIATPGMIVRPFSKIVETVAQKICEKLKESGLPVGGNEKKAKLKTTVTSLNARMNSDQFAVNITGDNSKWNECQQPEAYLALLAYITKDSSDLMKDLCSVAPVLFCNKFVKLGQGIRLSNKRKTKEVIIKAEKMGKYKNLMREEYKNLFEPLEKYIQKDVCFLPGGMLMGMFNMLSTVLGVSTLCYMDEELKAKGCFWTGLQSSDDFVLFAVASNWSNIHWTIRRFNAVCKLIGINMSLEKSYGSLPELFEFTSMFFDGEFVSNLAMELPAFTTAGVNEGVDFTAAMSIIKTNMINNSLSPSTALMALRICLQEFRATYRVHPWDSRVKGGRMKIINEFIKTIENKDGLLIADGGKLMNNISTLHIPEEVLKFEKMDEQYRNRVFNPKNPFTNFDKTIDIFRAHGPIRVEENEAVVSTHSFRTRANRTLLNTDMRAMMAEEKRYQMVCDMFKSVFESADINPPIGAMSIGEAIEEKLLERAKMKRDIGAIEDSEYEEIKDIIRDAKKARLESR

Source Source

Source organism organism	Influenza C virus (strain C/Johannesburg/1/1966)
NCBI taxonomy ID ncbi_taxonomy_id	100673
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Polymerase basic protein 2
Molecular weight formula_weight	104272.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F

MSLLLTIAKEYKRLCQDAKAAQMMTVGTVSNYTTFKKWTTSRKEKNPSLRMRWAMSSKFPIIANKRMLEEAQIPKEHNNVALWEDTEDVSKRDHVLASASCINYWNFCGPCVNNSEVIKEVYKSRFGRLERRKEIMWKELRFTLVDRQRRRVDTQPVEQRLRTGEIKDLQMWTLFEDEAPLASKFILDNYGLVKEMRSKFANKPLNKEVVAHMLEKQFNPESRFLPVFGAIRPERMELIHALGGETWIQEANTAGISNVDQRKNDIRAVCRKVCLAANASIMNAKSKLVEYIKSTSMRIGETERKLEELILETDDVSPEVTLCKSALGGQLGKTLSFGPMLLKKISGSGVKVKDTVYIQGVRAVQFEYWSEQEEFYGEYKSATALFSRKERSLEWITIGGGINEDRKRLLAMCMIFCRDGDYFKDAPATITMADLSTKLGREIPYQYVMMNWIQKSEDNLEALLYSRGIVETNPGKMGSSMGIDGSKRAIKSLRAVTIQSGKIDMPESKEKIHLELSDNLEAFDSSGRIVATILDLPSDKKVTFQDVSFQHPDLAVLRDEKTAITKGYEALIKRLGTGDNDIPSLIAKKDYLSLYNLPEVKLMAPLIRPNRKGVYSRVARKLVSTQVTTGHYSLHELIKVLPFTYFAPKQGMFEGRLFFSNDSFVEPGVNNNVFSWSKADSSKIYCHGIAIRVPLVVGDEHMDTSLALLEGFSVCENDPRAPMVTRQDLIDVGFGQKVRLFVGQGSVRTFKRTASQRAASSDVNKNVKKIKMSNENLYFQGELKTAALAQHDEAVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPKVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKADPSQSANLLAEAKKLNGAQAPKVDANSAGKST

Source Source

Source organism organism	Influenza C virus (strain C/Johannesburg/1/1966)
NCBI taxonomy ID ncbi_taxonomy_id	100673
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	Acidic leucine-rich nuclear phosphoprotein 32 family member A
Molecular weight formula_weight	30328.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

HHHHHHLEVLFEGPMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	6xzqA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	91 — Restriction Endonuclease
Homologous superfamily homologous superfamily	90 — Influenza RNA-dependent RNA polymerase subunit PA, endonuclease domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	85000

Influenza C virus polymerase in complex with human ANP32A - Subclass 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase acidic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA-directed RNA polymerase catalytic subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polymerase basic protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acidic leucine-rich nuclear phosphoprotein 32 family member A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6xzq__assembly_1__model_1

6xzq__assembly_1__model_1 | I(q)

6xzq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)