SAXSdb — 7agx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Surface presentation of antigens protein SpaP

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） Protein PrgI × 17 （P41784）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAP_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–224； UniProt 1–224 Author chain 1B； PDBConstruct 1–224； UniProt 1–224 Author chain 1C； PDBConstruct 1–224； UniProt 1–224 Author chain 1D； PDBConstruct 1–224； UniProt 1–224 Author chain 1E； PDBConstruct 1–224； UniProt 1–224

Surface presentation of antigens protein SpaR

OrganismNot specified

UniProt P40701

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） Protein PrgI × 17 （P41784）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAR_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1F； PDBConstruct 1–263； UniProt 1–263

Surface presentation of antigens protein SpaQ

OrganismNot specified

UniProt P0A1L7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Protein PrgJ × 6 （P41785） Protein PrgI × 17 （P41784）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAQ_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1G； PDBConstruct 1–86； UniProt 1–86 Author chain 1H； PDBConstruct 1–86； UniProt 1–86 Author chain 1I； PDBConstruct 1–86； UniProt 1–86 Author chain 1J； PDBConstruct 1–86； UniProt 1–86

Protein PrgJ

OrganismNot specified

UniProt P41785

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgI × 17 （P41784）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGJ_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 1K； PDBConstruct 1–101； UniProt 1–101 Author chain 1L； PDBConstruct 1–101； UniProt 1–101 Author chain 1M； PDBConstruct 1–101； UniProt 1–101 Author chain 1N； PDBConstruct 1–101； UniProt 1–101 Author chain 1O； PDBConstruct 1–101； UniProt 1–101 Author chain 1P； PDBConstruct 1–101； UniProt 1–101

Protein PrgI

OrganismNot specified

UniProt P41784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGI_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–80； UniProt 1–80 Author chain 2B； PDBConstruct 1–80； UniProt 1–80 Author chain 2C； PDBConstruct 1–80； UniProt 1–80 Author chain 2D； PDBConstruct 1–80； UniProt 1–80 Author chain 2E； PDBConstruct 1–80； UniProt 1–80 Author chain 2F； PDBConstruct 1–80； UniProt 1–80 Author chain 2G； PDBConstruct 1–80； UniProt 1–80 Author chain 2H； PDBConstruct 1–80； UniProt 1–80 Author chain 2I； PDBConstruct 1–80； UniProt 1–80 Author chain 2J； PDBConstruct 1–80； UniProt 1–80 Author chain 2K； PDBConstruct 1–80； UniProt 1–80 Author chain 2L； PDBConstruct 1–80； UniProt 1–80 Author chain 2M； PDBConstruct 1–80； UniProt 1–80 Author chain 2N； PDBConstruct 1–80； UniProt 1–80 Author chain 2O； PDBConstruct 1–80； UniProt 1–80 Author chain 2P； PDBConstruct 1–80； UniProt 1–80 Author chain 2Q； PDBConstruct 1–80； UniProt 1–80

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7agx
Deposition date deposition_date	2020-09-23
Structure title title	Apo-state type 3 secretion system export apparatus complex from Salmonella enterica typhimurium
Keywords keywords	T3SS, Export Apparatus, Injectisome, Needle Complex, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7agx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7agx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7agx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.60 Å
Rg (electron density)	53.22 Å
Total Rg	53.23 Å
Atom count	47749
Residues	3031
Excluded volume	429160 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7agx__assembly_1__model_1`	33-meric （33）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Surface presentation of antigens protein SpaP
Molecular weight formula_weight	25249.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1A,1B,1C,1D,1E
Atom count atom_count	47749

MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGVALLLSMFVMWPIMHDAYVYFEDEDVTFNDISSLSKHVDEGLDGYRDYLIKYSDRELVQFFENAQLKRQYGEETETVKRDKDEIEKPSIFALLPAYALSEIKSAFKIGFYLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDIAT

Entity 2 Entity 2 polymer

Description description	Surface presentation of antigens protein SpaR
Molecular weight formula_weight	28499.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1F

MFYALYFEIHHLVASAALGFARVAPIFFFLPFLNSGVLSGAPRNAIIILVALGVWPHALNEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDNQRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNECTPSLPPLLTFINQVAQNALVLASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGIAVLIMLLYFSPVLPDNVLRLSFQATGLSSWFYERGATHVLE

Entity 3 Entity 3 polymer

Description description	Surface presentation of antigens protein SpaQ
Molecular weight formula_weight	9363.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1G,1H,1I,1J

MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIFLALAKG

Entity 4 Entity 4 polymer

Description description	Protein PrgJ
Molecular weight formula_weight	10934.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1K,1L,1M,1N,1O,1P

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Entity 5 Entity 5 polymer

Description description	Protein PrgI
Molecular weight formula_weight	8864.9 kDa
Source method src_method	nat
Copy count entity_count	17

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2A,2B,2C,2D,2E,2F,2G,2H,2I,2J,2K,2L,2M,2N,2O,2P,2Q

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	54491

Apo-state type 3 secretion system export apparatus complex from Salmonella enterica typhimurium

1. Protein Identity and Related Structures Protein Identity & Related Structures

Surface presentation of antigens protein SpaP

State in the Current Structure

Other States of the Same Protein in the Database

Surface presentation of antigens protein SpaR

State in the Current Structure

Other States of the Same Protein in the Database

Surface presentation of antigens protein SpaQ

State in the Current Structure

Other States of the Same Protein in the Database

Protein PrgJ

State in the Current Structure

Other States of the Same Protein in the Database

Protein PrgI

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7agx__assembly_1__model_1

7agx__assembly_1__model_1 | I(q)

7agx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

Apo-state type 3 secretion system export apparatus complex from Salmonella enterica typhimurium

1. Protein Identity and Related Structures Protein Identity & Related Structures

Surface presentation of antigens protein SpaP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein PrgJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein PrgI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7agx__assembly_1__model_1

7agx__assembly_1__model_1 | I(q)

7agx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)