7o3h

Murine CIII2 focus-refined from supercomplex CICIII2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–446； UniProt 35–480 Author chain L； PDBConstruct 1–446； UniProt 35–480

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt Q9DB77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–439； UniProt 15–453 Author chain M； PDBConstruct 1–439； UniProt 15–453

Cytochrome b

OrganismNot specified

UniProt P00158

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–381； UniProt 1–381 Author chain N； PDBConstruct 1–381； UniProt 1–381

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt Q9D0M3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 85–325 Author chain O； PDBConstruct 1–241； UniProt 85–325

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt Q9CR68

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_MOUSE
Isoform	—
PDB entities	5, 11
Chains and sequence ranges	Author chain E； PDBConstruct 1–196； UniProt 79–274 Author chain P； PDBConstruct 1–196； UniProt 79–274 Author chain T； PDBConstruct 1–78； UniProt 1–78

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt Q9CQB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9CQB4_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–110； UniProt 2–111 Author chain Q； PDBConstruct 1–110； UniProt 2–111

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt Q9CQ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–81； UniProt 2–82 Author chain R； PDBConstruct 1–81； UniProt 2–82

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P99028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–76； UniProt 14–89 Author chain S； PDBConstruct 1–76； UniProt 14–89

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q8R1I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–63； UniProt 2–64 Author chain U； PDBConstruct 1–63； UniProt 2–64

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt Q9CPX8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 2 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CARDIOLIPIN × 6 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–56； UniProt 1–56 Author chain V； PDBConstruct 1–56； UniProt 1–56

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o3h
Deposition date deposition_date	2021-04-01
Structure title title	Murine CIII2 focus-refined from supercomplex CICIII2
Keywords keywords	mitochondria, respiratory chain, supercomplex, OXIDOREDUCTASE, complex III, complex IV, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o3h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o3h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o3h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.00 Å
Rg (electron density)	54.12 Å
Total Rg	54.28 Å
Atom count	33700
Residues	4161
Excluded volume	603120 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o3h__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	49355.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	33700

TATFAQALQSVPETQVSILDNGLRVASEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRHYKAPRMVLAAAGGVEHQQLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPDNVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVCDAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	46641.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

SLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSRIGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNMRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVADADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43240.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLYP

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27312.2 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21524.4 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

SHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13456.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

AGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9652.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

GREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	9002.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7326.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

SSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6546.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,V

MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD

Entity 11 Entity 11 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7900.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAAARPLVATVGLNVPASVRF

Entity 12 Entity 12 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 13 Entity 13 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 14 Entity 14 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 15 Entity 15 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 17 Entity 17 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7o3hA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3hA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3hE01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	7o3hL01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3hL02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3hP01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	129

Murine CIII2 focus-refined from supercomplex CICIII2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer