7o3e

Murine supercomplex CIII2CIV in the intermediate locked conformation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–446； UniProt 35–480 Author chain L； PDBConstruct 1–446； UniProt 35–480

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt Q9DB77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–439； UniProt 15–453 Author chain M； PDBConstruct 1–439； UniProt 15–453

Cytochrome b

OrganismNot specified

UniProt P00158

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–381； UniProt 1–381 Author chain N； PDBConstruct 1–381； UniProt 1–381

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt Q9D0M3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 85–325 Author chain O； PDBConstruct 1–241； UniProt 85–325

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt Q9CQB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9CQB4_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–110； UniProt 2–111 Author chain Q； PDBConstruct 1–110； UniProt 2–111

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt Q9CQ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–81； UniProt 2–82 Author chain R； PDBConstruct 1–81； UniProt 2–82

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P99028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–76； UniProt 14–89 Author chain S； PDBConstruct 1–76； UniProt 14–89

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt Q9CR68

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_MOUSE
Isoform	—
PDB entities	8, 9
Chains and sequence ranges	Author chain P； PDBConstruct 1–196； UniProt 79–274 Author chain T； PDBConstruct 1–78； UniProt 1–78

Cox7a2l protein

OrganismNot specified

UniProt Q99KD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q99KD6_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–113； UniProt 1–113

Cytochrome c oxidase subunit 1

OrganismNot specified

UniProt P00397

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a； PDBConstruct 1–514； UniProt 1–514

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain b； PDBConstruct 1–227； UniProt 1–227

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00416

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain c； PDBConstruct 1–261； UniProt 1–261

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

OrganismNot specified

UniProt P19783

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain d； PDBConstruct 1–147； UniProt 23–169

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P12787

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain e； PDBConstruct 1–109； UniProt 38–146

Cytochrome c oxidase subunit 5B, mitochondrial

OrganismNot specified

UniProt P19536

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain f； PDBConstruct 1–99； UniProt 30–128

Cytochrome c oxidase subunit 6A2, mitochondrial

OrganismNot specified

UniProt P43023

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A2_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain g； PDBConstruct 1–85； UniProt 13–97

Cytochrome c oxidase subunit 6B1

OrganismNot specified

UniProt P56391

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6B1_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain h； PDBConstruct 1–85； UniProt 2–86

Cytochrome c oxidase subunit 6C

OrganismNot specified

UniProt Q9CPQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain i； PDBConstruct 1–75； UniProt 2–76

Cytochrome c oxidase subunit 7B, mitochondrial

OrganismNot specified

UniProt P56393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain k； PDBConstruct 1–56； UniProt 25–80

Cytochrome c oxidase subunit 7C, mitochondrial

OrganismNot specified

UniProt P17665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain l； PDBConstruct 1–47； UniProt 17–63

Cytochrome c oxidase subunit 8B, mitochondrial

OrganismNot specified

UniProt P48772

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8B_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain m； PDBConstruct 1–46； UniProt 25–70

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q8R1I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 31	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 1 （Q9CR68） Cytochrome b-c1 complex subunit 9 × 1 （Q9CR68） Cox7a2l protein × 1 （Q99KD6） Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A2, mitochondrial × 1 （P43023） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 8B, mitochondrial × 1 （P48772） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 5 HEME C × 2 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 MAGNESIUM ION × 1 DINUCLEAR COPPER ION × 1 ZINC ION × 1 TRISTEAROYLGLYCEROL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain J； PDBConstruct 1–63； UniProt 2–64 Author chain U； PDBConstruct 1–63； UniProt 2–64

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o3e
Deposition date deposition_date	2021-04-01
Structure title title	Murine supercomplex CIII2CIV in the intermediate locked conformation
Keywords keywords	mitochondria, respiratory chain, supercomplex, OXIDOREDUCTASE, complex III, complex IV, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o3e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o3e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o3e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.38 Å
Rg (electron density)	63.69 Å
Total Rg	63.79 Å
Atom count	44039
Residues	5417
Excluded volume	791050 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o3e__assembly_1__model_1`	31-meric （31）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	49355.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	44039

TATFAQALQSVPETQVSILDNGLRVASEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRHYKAPRMVLAAAGGVEHQQLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPDNVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVCDAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	46641.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

SLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSRIGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNMRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVADADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43240.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLYP

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27312.2 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13456.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

AGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9652.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

GREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	9002.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

GDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	21524.4 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

SHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7900.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAAARPLVATVGLNVPASVRF

Entity 10 Entity 10 polymer

Description description	Cox7a2l protein
Molecular weight formula_weight	12575.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLTSSVTAYDYSGKNKVPELQKFFQKADGVPIHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	56945.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGFTLDDTWAKAHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	25993.3 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	29948.7 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS

Entity 14 Entity 14 polymer

Description description	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Molecular weight formula_weight	17225.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

AHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK

Entity 15 Entity 15 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	12453.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Entity 16 Entity 16 polymer

Description description	Cytochrome c oxidase subunit 5B, mitochondrial
Molecular weight formula_weight	10862.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MASGGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAASGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQMAH

Entity 17 Entity 17 polymer

Description description	Cytochrome c oxidase subunit 6A2, mitochondrial
Molecular weight formula_weight	9437.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

ASAAKGDHGGAGANTWRLLTFVLALPGVALCSLNCWMHAGHHERPEFIPYHHLRIRTKPFAWGDGNHTLFHNPHVNPLPTGYEHP

Entity 18 Entity 18 polymer

Description description	Cytochrome c oxidase subunit 6B1
Molecular weight formula_weight	9955.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

AEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEGTFPGKI

Entity 19 Entity 19 polymer

Description description	Cytochrome c oxidase subunit 6C
Molecular weight formula_weight	8352.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

SSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMKDFEEMRKAGIFQSAK

Entity 20 Entity 20 polymer

Description description	Cytochrome c oxidase subunit 7B, mitochondrial
Molecular weight formula_weight	6317.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

SHQKRAPSFHDKYGNAILAGGAIFCVSTWTYTATQIGIEWNMSPVGRVTPKEWRDQ

Entity 21 Entity 21 polymer

Description description	Cytochrome c oxidase subunit 7C, mitochondrial
Molecular weight formula_weight	5451.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

SHYEEGPGKNLPFSVENKWRLLAMMTVYFGSGFAAPFFIVRHQLLKK

Entity 22 Entity 22 polymer

Description description	Cytochrome c oxidase subunit 8B, mitochondrial
Molecular weight formula_weight	4660.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

VSAKPAKTPTSAVEQAVGISAIVVGFMVPAGWVLAHLESYKKSSAA

Entity 23 Entity 23 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7326.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

SSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 24 Entity 24 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 26 Entity 26 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 27 Entity 27 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 30 Entity 30 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 32 Entity 32 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 34 Entity 34 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 35 Entity 35 non-polymer

Description description	TRISTEAROYLGLYCEROL
Molecular weight formula_weight	891.5 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

Domain ID domain_id	7o3eA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3eA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3eL01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3eL02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	7o3ea01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	7o3eb01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	7o3eb02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	8426

Murine supercomplex CIII2CIV in the intermediate locked conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cox7a2l protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer